Scaffold TahiMoana_1017470

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold TahiMoana_1017470

Scaffold TahiMoana_1017470

Overview

Basic Information
Taxon OID	3300001679 Open in IMG/M
Scaffold ID	TahiMoana_1017470 Open in IMG/M
Source Dataset Name	Black smokers hydrothermal plume microbial communities from Tahi Moana, Lau Basin, Pacific Ocean
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2706
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (62.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Tahi Moana, Lau Basin, Pacific Ocean

Source Dataset Sampling Location
Location Name	Tahi Moana, Lau Basin, Pacific Ocean
Coordinates	Lat. (^o)	-20.682131	Long. (^o)	-176.183363	Alt. (m)		Depth (m)	2230
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067242	Metagenome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
TahiMoana_10174704	F067242	N/A	MKLSKGAKSRIRLMTNPERKSLCKQARALAEAEIITMKRAEAVIRWCNKGGY*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.