Scaffold Mariner_1001638

Overview

Basic Information

• Taxon OID: 3300001678
• Scaffold ID: Mariner_1001638
• Source Dataset Name: Black smokers hydrothermal plume microbial communities from Mariner, Lau Basin, Pacific Ocean -IDBA
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 12078
• Total Scaffold Genes: 17
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (29.41%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Mariner, Lau Basin, Pacific Ocean

Source Dataset Sampling Location

• Location Name: Mariner, Lau Basin, Pacific Ocean
• Coordinates
  • Lat. (^o): -20.180059
  • Long. (^o): -176.601242
  • Depth (m): 1900

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084703	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Mariner_10016381	F084703	N/A	VLPSSLPRELFSTTAPRFLPDKLEPLGLSLSGQLRVAS*