| Basic Information | |
|---|---|
| Taxon OID | 3300001662 Open in IMG/M |
| Scaffold ID | sbbSud_100224 Open in IMG/M |
| Source Dataset Name | sbbS |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 717 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Basin, California, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California, Santa Barbara Basin | |||||||
| Coordinates | Lat. (o) | 34.2500169 | Long. (o) | -122.2912323 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F008782 | Metagenome / Metatranscriptome | 328 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| sbbSud_1002242 | F008782 | N/A | MKKPIFRVFVSYEIKSKKVVTRKVITGILDTFVLTSNTKEIENDQELIDRICYINKKNLNKVDVIITSIDIENQYGETADRFDDEY* |
| ⦗Top⦘ |