NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold sbbSud_100224

Scaffold sbbSud_100224


Overview

Basic Information
Taxon OID3300001662 Open in IMG/M
Scaffold IDsbbSud_100224 Open in IMG/M
Source Dataset NamesbbS
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)717
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Basin, California, Usa

Source Dataset Sampling Location
Location NameUSA: California, Santa Barbara Basin
CoordinatesLat. (o)34.2500169Long. (o)-122.2912323Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008782Metagenome / Metatranscriptome328Y

Sequences

Protein IDFamilyRBSSequence
sbbSud_1002242F008782N/AMKKPIFRVFVSYEIKSKKVVTRKVITGILDTFVLTSNTKEIENDQELIDRICYINKKNLNKVDVIITSIDIENQYGETADRFDDEY*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.