Scaffold Draft_10437660

Overview

Basic Information

• Taxon OID: 3300001605
• Scaffold ID: Draft_10437660
• Source Dataset Name: Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: McGill University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 689
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location

• Location Name: Fort McMurray in northeastern Alberta, Canada
• Coordinates
  • Lat. (^o): 57.01116
  • Long. (^o): -111.6
  • Depth (m): 0 to .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062685	Metagenome	130	N

Sequences

Protein ID	Family	RBS	Sequence
Draft_104376601	F062685	N/A	ADLWKIKHGKRDALGMIYRGIFEPICYVVGKVKGGK*