Basic Information | |
---|---|
Family ID | F062685 |
Family Type | Metagenome |
Number of Sequences | 130 |
Average Sequence Length | 43 residues |
Representative Sequence | EHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGK |
Number of Associated Samples | 84 |
Number of Associated Scaffolds | 130 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 96.92 % |
% of genes from short scaffolds (< 2000 bps) | 75.38 % |
Associated GOLD sequencing projects | 79 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (85.385 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (24.615 % of family members) |
Environment Ontology (ENVO) | Unclassified (49.231 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (51.538 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.81% β-sheet: 0.00% Coil/Unstructured: 44.19% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 130 Family Scaffolds |
---|---|---|
PF05772 | NinB | 0.77 |
PF00959 | Phage_lysozyme | 0.77 |
PF16754 | Pesticin | 0.77 |
PF13482 | RNase_H_2 | 0.77 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.08 % |
Unclassified | root | N/A | 6.92 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001605|Draft_10437660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 689 | Open in IMG/M |
3300003394|JGI25907J50239_1009360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2315 | Open in IMG/M |
3300005528|Ga0068872_10217338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1084 | Open in IMG/M |
3300005528|Ga0068872_10291142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 908 | Open in IMG/M |
3300005584|Ga0049082_10224208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 639 | Open in IMG/M |
3300005805|Ga0079957_1028317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3752 | Open in IMG/M |
3300005805|Ga0079957_1324225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 684 | Open in IMG/M |
3300006802|Ga0070749_10020416 | All Organisms → cellular organisms → Bacteria | 4200 | Open in IMG/M |
3300006875|Ga0075473_10007861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4169 | Open in IMG/M |
3300007542|Ga0099846_1333070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 516 | Open in IMG/M |
3300007622|Ga0102863_1047613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1249 | Open in IMG/M |
3300007622|Ga0102863_1213784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 567 | Open in IMG/M |
3300007622|Ga0102863_1225132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 551 | Open in IMG/M |
3300007734|Ga0104986_1397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14611 | Open in IMG/M |
3300007973|Ga0105746_1205662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 673 | Open in IMG/M |
3300007974|Ga0105747_1271300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 571 | Open in IMG/M |
3300007992|Ga0105748_10427640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 573 | Open in IMG/M |
3300008107|Ga0114340_1207464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 649 | Open in IMG/M |
3300008110|Ga0114343_1228419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 515 | Open in IMG/M |
3300008113|Ga0114346_1005803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7554 | Open in IMG/M |
3300008120|Ga0114355_1062872 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 1617 | Open in IMG/M |
3300008266|Ga0114363_1007610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 6169 | Open in IMG/M |
3300008266|Ga0114363_1013744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3729 | Open in IMG/M |
3300008266|Ga0114363_1045620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1769 | Open in IMG/M |
3300008266|Ga0114363_1114130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 950 | Open in IMG/M |
3300008266|Ga0114363_1158536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 743 | Open in IMG/M |
3300008266|Ga0114363_1195032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 628 | Open in IMG/M |
3300008448|Ga0114876_1232582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 590 | Open in IMG/M |
3300008448|Ga0114876_1260881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 528 | Open in IMG/M |
3300008450|Ga0114880_1015698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3615 | Open in IMG/M |
3300008450|Ga0114880_1029271 | Not Available | 2473 | Open in IMG/M |
3300009056|Ga0102860_1012013 | Not Available | 2148 | Open in IMG/M |
3300009081|Ga0105098_10006177 | All Organisms → cellular organisms → Bacteria | 4325 | Open in IMG/M |
3300009165|Ga0105102_10268499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
3300009168|Ga0105104_10592453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 630 | Open in IMG/M |
3300009168|Ga0105104_10957279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 505 | Open in IMG/M |
3300009169|Ga0105097_10604483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 617 | Open in IMG/M |
3300009183|Ga0114974_10033698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3519 | Open in IMG/M |
3300009183|Ga0114974_10451086 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 728 | Open in IMG/M |
3300010354|Ga0129333_10198360 | All Organisms → Viruses → Predicted Viral | 1826 | Open in IMG/M |
3300010885|Ga0133913_11572551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1661 | Open in IMG/M |
3300011183|Ga0136713_1011961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1092 | Open in IMG/M |
3300012266|Ga0136712_1017336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 796 | Open in IMG/M |
3300012266|Ga0136712_1045271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 517 | Open in IMG/M |
3300013004|Ga0164293_10300516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1113 | Open in IMG/M |
3300013004|Ga0164293_10310565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1089 | Open in IMG/M |
3300013004|Ga0164293_10416313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 902 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10109711 | Not Available | 1918 | Open in IMG/M |
3300017722|Ga0181347_1028270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1751 | Open in IMG/M |
3300017722|Ga0181347_1149634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 638 | Open in IMG/M |
3300017736|Ga0181365_1067528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 884 | Open in IMG/M |
3300017761|Ga0181356_1017866 | All Organisms → Viruses → Predicted Viral | 2624 | Open in IMG/M |
3300017761|Ga0181356_1096969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 964 | Open in IMG/M |
3300017761|Ga0181356_1218966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 555 | Open in IMG/M |
3300017774|Ga0181358_1101486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1030 | Open in IMG/M |
3300017774|Ga0181358_1198362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 658 | Open in IMG/M |
3300017774|Ga0181358_1202734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 648 | Open in IMG/M |
3300017777|Ga0181357_1038401 | Not Available | 1882 | Open in IMG/M |
3300017777|Ga0181357_1177082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 773 | Open in IMG/M |
3300017778|Ga0181349_1045983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1722 | Open in IMG/M |
3300017778|Ga0181349_1273525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 556 | Open in IMG/M |
3300017780|Ga0181346_1072299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1369 | Open in IMG/M |
3300017780|Ga0181346_1086311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1231 | Open in IMG/M |
3300017784|Ga0181348_1191691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 739 | Open in IMG/M |
3300017784|Ga0181348_1227978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 654 | Open in IMG/M |
3300017785|Ga0181355_1035874 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2131 | Open in IMG/M |
3300018048|Ga0181606_10510778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 627 | Open in IMG/M |
3300018420|Ga0181563_10463247 | Not Available | 716 | Open in IMG/M |
3300019784|Ga0181359_1079241 | All Organisms → Viruses → Predicted Viral | 1233 | Open in IMG/M |
3300019784|Ga0181359_1174763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 715 | Open in IMG/M |
3300021962|Ga0222713_10047030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 3325 | Open in IMG/M |
3300021963|Ga0222712_10702248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 570 | Open in IMG/M |
3300022179|Ga0181353_1002275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4125 | Open in IMG/M |
3300022179|Ga0181353_1111814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 661 | Open in IMG/M |
3300022190|Ga0181354_1123466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 830 | Open in IMG/M |
3300022407|Ga0181351_1022506 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2670 | Open in IMG/M |
3300022407|Ga0181351_1101348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1112 | Open in IMG/M |
3300022407|Ga0181351_1205552 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 653 | Open in IMG/M |
3300024298|Ga0255178_1065407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 691 | Open in IMG/M |
3300024495|Ga0255164_1074902 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 527 | Open in IMG/M |
3300025445|Ga0208424_1010559 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1043 | Open in IMG/M |
3300025889|Ga0208644_1280173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 673 | Open in IMG/M |
3300027213|Ga0208555_1040285 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 730 | Open in IMG/M |
3300027508|Ga0255072_1123586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 503 | Open in IMG/M |
3300027586|Ga0208966_1064775 | All Organisms → Viruses → Predicted Viral | 1028 | Open in IMG/M |
3300027732|Ga0209442_1029788 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2469 | Open in IMG/M |
3300027759|Ga0209296_1023006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 3527 | Open in IMG/M |
3300027759|Ga0209296_1260491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 708 | Open in IMG/M |
3300027785|Ga0209246_10022557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2367 | Open in IMG/M |
3300027798|Ga0209353_10316314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 658 | Open in IMG/M |
3300028025|Ga0247723_1024455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1984 | Open in IMG/M |
3300031707|Ga0315291_10625838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 971 | Open in IMG/M |
3300031707|Ga0315291_11151390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 639 | Open in IMG/M |
3300031758|Ga0315907_10313402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1285 | Open in IMG/M |
3300031772|Ga0315288_10986681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 752 | Open in IMG/M |
3300031772|Ga0315288_11151962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 673 | Open in IMG/M |
3300031787|Ga0315900_10189157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 1841 | Open in IMG/M |
3300031787|Ga0315900_10940954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 575 | Open in IMG/M |
3300031857|Ga0315909_10055595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 3629 | Open in IMG/M |
3300031857|Ga0315909_10201555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1576 | Open in IMG/M |
3300031951|Ga0315904_10070929 | All Organisms → Viruses → Predicted Viral | 3774 | Open in IMG/M |
3300031951|Ga0315904_10441518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1166 | Open in IMG/M |
3300031951|Ga0315904_10779159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 790 | Open in IMG/M |
3300031951|Ga0315904_10844185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 747 | Open in IMG/M |
3300031963|Ga0315901_10172674 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 1902 | Open in IMG/M |
3300031963|Ga0315901_10261007 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1458 | Open in IMG/M |
3300032050|Ga0315906_10062433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3829 | Open in IMG/M |
3300032050|Ga0315906_10209195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1828 | Open in IMG/M |
3300032053|Ga0315284_10503250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1469 | Open in IMG/M |
3300032053|Ga0315284_10716501 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1172 | Open in IMG/M |
3300032093|Ga0315902_10183403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ct2cs2 | 2128 | Open in IMG/M |
3300032116|Ga0315903_10046669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4452 | Open in IMG/M |
3300032118|Ga0315277_10577052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1109 | Open in IMG/M |
3300032118|Ga0315277_10632189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1044 | Open in IMG/M |
3300032118|Ga0315277_11473001 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 585 | Open in IMG/M |
3300032177|Ga0315276_10744300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1051 | Open in IMG/M |
3300032516|Ga0315273_10348726 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 2003 | Open in IMG/M |
3300033996|Ga0334979_0023680 | All Organisms → Viruses → Predicted Viral | 4140 | Open in IMG/M |
3300033996|Ga0334979_0217012 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1120 | Open in IMG/M |
3300033996|Ga0334979_0306755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 900 | Open in IMG/M |
3300034012|Ga0334986_0595805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 527 | Open in IMG/M |
3300034082|Ga0335020_0166153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1110 | Open in IMG/M |
3300034101|Ga0335027_0679271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 615 | Open in IMG/M |
3300034101|Ga0335027_0748188 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 573 | Open in IMG/M |
3300034102|Ga0335029_0312568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 986 | Open in IMG/M |
3300034102|Ga0335029_0373853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 870 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 24.62% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 11.54% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 10.00% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 9.23% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 7.69% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.85% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.85% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 3.85% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.85% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.08% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.31% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.31% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.31% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.54% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.54% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.54% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.54% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 1.54% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.77% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.77% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.77% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.77% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.77% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300011183 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - JTO22cm metaG | Environmental | Open in IMG/M |
3300012266 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - JTO19cm metaG | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300024298 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepC_8d | Environmental | Open in IMG/M |
3300024495 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d | Environmental | Open in IMG/M |
3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300027213 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 (SPAdes) | Environmental | Open in IMG/M |
3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
Draft_104376601 | 3300001605 | Hydrocarbon Resource Environments | ADLWKIKHGKRDALGMIYRGIFEPICYVVGKVKGGK* |
JGI25907J50239_10093601 | 3300003394 | Freshwater Lake | IARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR* |
Ga0068872_102173383 | 3300005528 | Freshwater Lake | ADIWKQKRGKKRDTYGMIYRAILEPICYVVGKVGR* |
Ga0068872_102911421 | 3300005528 | Freshwater Lake | LQRILRGVLEHIARHRTADIWKQKRGKKRDVYGMIYRAILEPICYVVGKVGK* |
Ga0049082_102242082 | 3300005584 | Freshwater Lentic | ARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR* |
Ga0079957_10283174 | 3300005805 | Lake | DIWKQKRGKKRDTYGMIYRAILEPICYAVGKVGK* |
Ga0079957_13242251 | 3300005805 | Lake | HRTADIWKQKRGKKRDNYGMIYRAILEPICYVVGKVGK* |
Ga0098038_10159951 | 3300006735 | Marine | RRTADIWLQQRGNKRHLGGRIERAILEPICYIVGKL* |
Ga0070749_100204161 | 3300006802 | Aqueous | ILRGVLEHIARHRTADIWKQKRGKKRDVYGMIYRAILEPICYVVGKVGK* |
Ga0075473_100078615 | 3300006875 | Aqueous | RNVLAHIARHRTADIYKQMRGNKRDTLGRVYRAILEPICYLVGKVS* |
Ga0099846_13330701 | 3300007542 | Aqueous | DIWKQKRGKRDKLGMIYRAILEPICFVVGKVKGA* |
Ga0102863_10476131 | 3300007622 | Estuarine | QRILRGVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR* |
Ga0102863_12137841 | 3300007622 | Estuarine | QRILRGVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVAK* |
Ga0102863_12251322 | 3300007622 | Estuarine | LEHIARHRTADIWKQKRGKTRDNLGMVYRFILEPICYVVGKVGK* |
Ga0104986_139733 | 3300007734 | Freshwater | HIARHRTADIWKQKRGKNRDTYGMIYRAILEPICYVAGKV* |
Ga0105746_12056622 | 3300007973 | Estuary Water | ILRGVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR* |
Ga0105747_12713001 | 3300007974 | Estuary Water | RTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR* |
Ga0105748_104276401 | 3300007992 | Estuary Water | IARHRTADIWKQKRGKTRDNLGMVYRFILEPICYVVGKVAK* |
Ga0114340_12074643 | 3300008107 | Freshwater, Plankton | TADIWKQKRGKTRDNLGMVYRFILEPICYVVGKVGR* |
Ga0114343_12284191 | 3300008110 | Freshwater, Plankton | HRTADIWKQKRGKNRDNIGMIYRFILEPICYVVGKVGK* |
Ga0114346_10058031 | 3300008113 | Freshwater, Plankton | GVLEHIARHRTADIWKQKRGKTRDNLGMVYRFILEPICYVVGKVGK* |
Ga0114355_10628723 | 3300008120 | Freshwater, Plankton | LEHIARHRTADIWKQKRGKKRDVYGMIYRAILEPICYVVGKVAK* |
Ga0114363_10076101 | 3300008266 | Freshwater, Plankton | LRGILEHIARHRTADIWKQKRGKKRDVYGMIYRAILEPICYVVGKVAK* |
Ga0114363_10137441 | 3300008266 | Freshwater, Plankton | LRGILEHIARHRTADIWKQKRGKKRDVYGMIYRAILEPICYVVGKVGK* |
Ga0114363_10456203 | 3300008266 | Freshwater, Plankton | VLEHIARHRTADIWKQKRGKKRDNYGMIYRAILEPICYVVGKVGK* |
Ga0114363_11141303 | 3300008266 | Freshwater, Plankton | QRILRGVLEHIARHRTADIWKQKRGKKRDNYGMIYRAILEPICYVVGKVGK* |
Ga0114363_11585363 | 3300008266 | Freshwater, Plankton | RHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR* |
Ga0114363_11950321 | 3300008266 | Freshwater, Plankton | RHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVAK* |
Ga0114876_12325821 | 3300008448 | Freshwater Lake | GVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR* |
Ga0114876_12608811 | 3300008448 | Freshwater Lake | IARHRTADIWKQKRGKKRDTYGMIYRAILEPICYVVGKVGK* |
Ga0114880_10156986 | 3300008450 | Freshwater Lake | QRILRGVLEHIARHRTADIWKQKRGKKRDVYGMIYRAILEPICYVVGKVGK* |
Ga0114880_10292714 | 3300008450 | Freshwater Lake | ADIWKQKRGKTRDNLGMFYRFILEPICYVVGKVGI* |
Ga0102860_10120131 | 3300009056 | Estuarine | HIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVAR* |
Ga0105098_100061771 | 3300009081 | Freshwater Sediment | ILRGVLEHIARHRTADIWKQKRGKNRDIYGMIYRAILEPICYVVGKVGK* |
Ga0105102_102684993 | 3300009165 | Freshwater Sediment | ADIWKQKRGKKRDVYGMIYRAILEPICYVVGKVGK* |
Ga0105104_105924532 | 3300009168 | Freshwater Sediment | IARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKV* |
Ga0105104_109572792 | 3300009168 | Freshwater Sediment | QRILRGVLEHIARHRTADIWKQKRGKTRDNLGMVYRFILEPICYVVGKVGK* |
Ga0105097_106044831 | 3300009169 | Freshwater Sediment | VLEHIARHRTADIWKQKRGKNRDTYGMIYRAILEPICYLVGKVGK* |
Ga0114974_100336981 | 3300009183 | Freshwater Lake | EHIARHRTADIWKQKRGKTRDTYGMIYRAILEPICYVVGKV* |
Ga0114974_104510863 | 3300009183 | Freshwater Lake | EHIARHRTADIWKQKRGKTRDTYGMIYRAILEPICYVVGKVAK* |
Ga0129333_101983601 | 3300010354 | Freshwater To Marine Saline Gradient | RILRGVLEHIARHRTADIWKQKRGKNRDTYGMIYRAILEPICYVVGKVGR* |
Ga0133913_115725513 | 3300010885 | Freshwater Lake | RGVLEHIARNRTADIWKQKRGKNRDNIGMVYRFILEPICYVVGKVGK* |
Ga0136713_10119613 | 3300011183 | Freshwater | TADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGK* |
Ga0136712_10173361 | 3300012266 | Freshwater | RILRGVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR* |
Ga0136712_10452711 | 3300012266 | Freshwater | RILRGVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGK* |
Ga0164293_103005161 | 3300013004 | Freshwater | HIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR* |
Ga0164293_103105651 | 3300013004 | Freshwater | HIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVAK* |
Ga0164293_104163133 | 3300013004 | Freshwater | ILRGVLEHIARHRTADIWKQKRSKKRDIYGMIYRAIIEPICYVVGKV* |
(restricted) Ga0172367_101097111 | 3300013126 | Freshwater | HIARHRTADIWKQKRGKNRDNLGMVYRFILEPICYVVGKVGR* |
Ga0181347_10282703 | 3300017722 | Freshwater Lake | LEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR |
Ga0181347_11496341 | 3300017722 | Freshwater Lake | TADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGK |
Ga0181365_10675281 | 3300017736 | Freshwater Lake | GVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGK |
Ga0181427_10360432 | 3300017745 | Seawater | AKRRTADIWLQQRGNKRHLGGRIERAILEPICYIVGKL |
Ga0181414_11016131 | 3300017759 | Seawater | SARRRTADIWLKKKGKRHLLGAVERAILEPLCYIVGKLNGRTN |
Ga0181356_10178666 | 3300017761 | Freshwater Lake | LRGVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR |
Ga0181356_10969691 | 3300017761 | Freshwater Lake | ADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR |
Ga0181356_12189661 | 3300017761 | Freshwater Lake | QRILRGVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVAK |
Ga0181358_11014862 | 3300017774 | Freshwater Lake | HIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYIVGKV |
Ga0181358_11983623 | 3300017774 | Freshwater Lake | ILRGVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGK |
Ga0181358_12027341 | 3300017774 | Freshwater Lake | GVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVAK |
Ga0181357_10384011 | 3300017777 | Freshwater Lake | RTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVAK |
Ga0181357_11770821 | 3300017777 | Freshwater Lake | HIARHRTADIWKQKRGKTRDNLGMVYRFILEPICYVVGKVGK |
Ga0181349_10459831 | 3300017778 | Freshwater Lake | RHRTADIWKQKRGKTRDNLGMFYRFILEPICYVVGKVGI |
Ga0181349_12735252 | 3300017778 | Freshwater Lake | HIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGK |
Ga0181346_10722991 | 3300017780 | Freshwater Lake | TADIWKQKRGKTRDNLGMFYRFILEPICYVVGKVAK |
Ga0181346_10863111 | 3300017780 | Freshwater Lake | TADIWKQKRGKTRDNTGMIYRAILEPVCYVIGKVAK |
Ga0181348_11916911 | 3300017784 | Freshwater Lake | HIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVAK |
Ga0181348_12279782 | 3300017784 | Freshwater Lake | RHRTADIWKQKRGKNRDNIGMIYRFILEPICYVVGKVGK |
Ga0181355_10358744 | 3300017785 | Freshwater Lake | LRGVLEHIARHRTADIWKQKRGKTRDNTGMIYRAILEPVCYVIGKVAK |
Ga0181606_105107781 | 3300018048 | Salt Marsh | TLEHIARHRTADIWKQKHGKRDWIGAAERAVLEPMCYVTGYIVKKLQDRK |
Ga0181563_104632472 | 3300018420 | Salt Marsh | ARRRTADIWLQQRGKKRHIGGRLERAILEPICYIVGKL |
Ga0181359_10792411 | 3300019784 | Freshwater Lake | IARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR |
Ga0181359_11747631 | 3300019784 | Freshwater Lake | IARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVAK |
Ga0222713_100470304 | 3300021962 | Estuarine Water | GVLEHIARHRTADIWKQKRGKNRDTYGMIYRAILEPICYVVGKVGK |
Ga0222712_107022481 | 3300021963 | Estuarine Water | EHIARHRTADIWKQKRGKKRDTYGMIYRAILEPICYVVGKVGR |
Ga0181353_10022756 | 3300022179 | Freshwater Lake | LEHIARHRTADIWKQKRGKTRDNTGMIYRAILEPICYVVGKVGK |
Ga0181353_11118143 | 3300022179 | Freshwater Lake | VLEHIARHRTADIWKQKRGKTRDNLGMVYRFILEPICYVVGKVGK |
Ga0181354_11234661 | 3300022190 | Freshwater Lake | GVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYIVGKV |
Ga0181351_10225061 | 3300022407 | Freshwater Lake | LEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVAK |
Ga0181351_11013481 | 3300022407 | Freshwater Lake | RHRTADIWKQKRGKTRDNTGMIYRAILEPVCYVIGKVAK |
Ga0181351_12055522 | 3300022407 | Freshwater Lake | GVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKV |
Ga0255178_10654071 | 3300024298 | Freshwater | LEHIARHRTADIWKQKRGKNRDTYGMIYRAILEPICYVVGKVGK |
Ga0255164_10749021 | 3300024495 | Freshwater | LRGVLEHIARHRTADIWKQKRGKNRDTYGMIYRAILEPICYAVGKVGK |
Ga0208424_10105593 | 3300025445 | Aqueous | GVLEHIARHRTADIWKQKRGKTRDTYGMIYRAILEPICYVVGKV |
Ga0208644_12801732 | 3300025889 | Aqueous | ILRGILEHIARHRTADIWKQKRGKKRDVYGMIYRAILEPICYVVGKVGK |
Ga0208555_10402852 | 3300027213 | Estuarine | ADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVAR |
Ga0255072_11235861 | 3300027508 | Freshwater | LEHIARHRTADIWKQKRGKTRDNLGMVYRFILEPICYVVGKVGR |
Ga0208966_10647751 | 3300027586 | Freshwater Lentic | QRILRGVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGK |
Ga0209442_10297881 | 3300027732 | Freshwater Lake | ARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR |
Ga0209296_10230061 | 3300027759 | Freshwater Lake | LEHIARHRTADIWKQKRGKTRDTYGMIYRAILEPICYVVGKV |
Ga0209296_12604913 | 3300027759 | Freshwater Lake | LEHIARHRTADIWKQKRGKTRDTYGMIYRAILEPICYVVGKVAK |
Ga0209246_100225575 | 3300027785 | Freshwater Lake | ILRGVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR |
Ga0209353_103163143 | 3300027798 | Freshwater Lake | HRTADIWKQKRGKTRDNLGMVYRFILEPICYVVGKVGK |
Ga0247723_10244551 | 3300028025 | Deep Subsurface Sediment | LQRILRGVLEHIARHRTADIWKQKRSKKRDTYGMIYRAIIEPICYVVGKV |
Ga0315291_106258381 | 3300031707 | Sediment | RGVLEHIARHRTADIWKQKRSKTRDNIGMIYRFILEPICYVVGKVAK |
Ga0315291_111513901 | 3300031707 | Sediment | EHIARHRTADIWKQKRGKTRDNIGMIYRFILEPICYVVGKVGR |
Ga0315907_103134021 | 3300031758 | Freshwater | EHIARHRTADIWKQKRGKKRDVYGMIYRAILEPICYVVGKVGK |
Ga0315288_109866812 | 3300031772 | Sediment | TADIWKQKRGKTRDNIGMIYRFILEPICYVVGKVGR |
Ga0315288_111519623 | 3300031772 | Sediment | TADIWKQKRGKTRDNIGMIYRFILEPICYVVGKVAK |
Ga0315900_101891573 | 3300031787 | Freshwater | ILRGVLEHIARHRTADIWKQKRGKKRDVYGMIYRAILEPICYVVGKVAK |
Ga0315900_109409542 | 3300031787 | Freshwater | VLEHIARHRTADIWKQKRGKKRDTYGMIYRAILEPICYVVGKVGK |
Ga0315909_100555951 | 3300031857 | Freshwater | LQRILRGVLEHIARHRTADIWKQKRGKNRDTYGMIYRAILEPICYVVGKVAK |
Ga0315909_102015551 | 3300031857 | Freshwater | LRGVLEHIARHRTADIWKQKRGKNRDNLGMVYRFILEPICYVVGKVGK |
Ga0315904_100709296 | 3300031951 | Freshwater | LRGVLEHIARHRTADIWKQKRGKKRDTYGMIYRAILEPICYVVGKVGR |
Ga0315904_104415183 | 3300031951 | Freshwater | ARHRTADIWKQKRGKKRDNYGMIYRAILEPICYVVGKVGK |
Ga0315904_107791592 | 3300031951 | Freshwater | ADIWKQKRGKKRDTYGMIYRAILEPICYVVGKVGR |
Ga0315904_108441851 | 3300031951 | Freshwater | RTADIWKQKRGKKRDTYGMIYRAILEPICYVVGKVGR |
Ga0315294_101582831 | 3300031952 | Sediment | GVLEHIARHRTADIWKQKRGKTRDNIGMIYRAIIEPICYVVGKV |
Ga0315901_101726741 | 3300031963 | Freshwater | EHIARHRTADIWKQKRGKKRDVYGMIYRAILEPICYVVGKVAK |
Ga0315901_102610071 | 3300031963 | Freshwater | IARHRTADIWKQKRGKKRDNYGMIYRAILEPICYVVGKVGK |
Ga0315906_100624331 | 3300032050 | Freshwater | RGILEHIARHRTADIWKQKRGKKRDVYGMIYRAILEPICYVVGKVGK |
Ga0315906_102091953 | 3300032050 | Freshwater | EHIARHRTADIWKQKRGKKRDNYGMIYRAILEPICYVVGKVGK |
Ga0315284_105032503 | 3300032053 | Sediment | HRTADIWKQKRGKNRDNIGMIYRAILEPICYVVGKVGR |
Ga0315284_107165011 | 3300032053 | Sediment | LEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPVCYVVGKVVK |
Ga0315902_101834033 | 3300032093 | Freshwater | LQRILRGILEHIARHRTADIWKQKRGKKRDVYGMIYRAILEPICYVVGKVAK |
Ga0315903_100466697 | 3300032116 | Freshwater | LQRILRGILEHIARHRTADIWKQKRGKKRDVYGMIYRAILEPICYVVGKVGK |
Ga0315277_105770521 | 3300032118 | Sediment | ILRGVLEHIARHRTADIWRQKRGKTRDNLGMFYRFILEPICYVVGKVGI |
Ga0315277_106321893 | 3300032118 | Sediment | VLEHIARHRTADIWKQKRGKTRDNLGMVYRFILEPICYVVGKVGR |
Ga0315277_114730011 | 3300032118 | Sediment | QRILRGVLEHIARHRTADIWKQKRGKTRDNTGMIYRAILEPICYVVGKVGR |
Ga0315276_107443003 | 3300032177 | Sediment | RTADIWKQKRGKTRDNIGMIYRFILEPICYVVGKVAK |
Ga0315273_103487264 | 3300032516 | Sediment | HIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVCR |
Ga0334979_0023680_3987_4139 | 3300033996 | Freshwater | RILRGVLEHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGR |
Ga0334979_0217012_988_1119 | 3300033996 | Freshwater | EHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVGK |
Ga0334979_0306755_790_900 | 3300033996 | Freshwater | TADIWKQKRGKTRDNIGMIYRAVLEPICYVVGKVAK |
Ga0334986_0595805_2_133 | 3300034012 | Freshwater | VLEHIARHRTADIWKQKRSKKRDTYGMIYRAILEPICYVVGKV |
Ga0335020_0166153_1_129 | 3300034082 | Freshwater | EHIARHRTADIWKQKRGKTRDNIGMIYRAILEPICYVVGKVK |
Ga0335027_0679271_3_158 | 3300034101 | Freshwater | QRILRGVLEHIARHRTADIWKQKRGKNRDNIGMIYRFILEPICYVVGKVGK |
Ga0335027_0748188_2_121 | 3300034101 | Freshwater | RHRTADIWKQKRGKTRDNLGMVYRFILEPICYVVGKVGK |
Ga0335029_0312568_860_985 | 3300034102 | Freshwater | IARHRTADIWKQKRGKTRDNLGMVYRFILEPICYVVGKVGK |
Ga0335029_0373853_1_126 | 3300034102 | Freshwater | IARHRTADIWKQKRGKTRDNLGMVYRFILEPICYVVGKVGR |
⦗Top⦘ |