Basic Information | |
---|---|
Taxon OID | 3300001598 Open in IMG/M |
Scaffold ID | EMG_10167256 Open in IMG/M |
Source Dataset Name | Elephant fecal microbiome from Asian Elephant in Hamburg Zoo, Germany |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1453 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Clostridiaceae → Clostridium → unclassified Clostridium → Clostridium sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Asian Elephant Fecal → Asian Elephant Fecal Microbial Communities From Hamburg Zoo, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hagenbeck zoo/Hamburg, Germany | |||||||
Coordinates | Lat. (o) | 53.595256 | Long. (o) | 9.941572 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036964 | Metagenome / Metatranscriptome | 169 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
EMG_101672563 | F036964 | AGGA | MINMLNIIFPSLMVAGAFGSLVTNLISKGEFPISLQWFGAMLLYTALLMRNLAK* |
⦗Top⦘ |