| Basic Information | |
|---|---|
| Taxon OID | 3300001598 Open in IMG/M |
| Scaffold ID | EMG_10011187 Open in IMG/M |
| Source Dataset Name | Elephant fecal microbiome from Asian Elephant in Hamburg Zoo, Germany |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 12697 |
| Total Scaffold Genes | 14 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (21.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctDOT22 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Asian Elephant Fecal → Asian Elephant Fecal Microbial Communities From Hamburg Zoo, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hagenbeck zoo/Hamburg, Germany | |||||||
| Coordinates | Lat. (o) | 53.595256 | Long. (o) | 9.941572 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F071326 | Metagenome / Metatranscriptome | 122 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| EMG_1001118713 | F071326 | N/A | MEGDGGMVSKLNEKAQQFYKLALQTIKVQLKLNGTKFIVKRPKDNSKWKNVFGGSYSSDETLENDYEPEFSTVLIVNTGEMRDVWNRNRDTLESYTNDGSLNIGDELQYNRGDRVYRFKITQKYGFSELSDSLFIYTLMSIIETYQ* |
| ⦗Top⦘ |