NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12001J15744_1012235

Scaffold JGI12001J15744_1012235


Overview

Basic Information
Taxon OID3300001587 Open in IMG/M
Scaffold IDJGI12001J15744_1012235 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Atlantic Ocean - MP2634
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1005
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameNortheast of Antigua and Barbuda, North Atlantic Ocean
CoordinatesLat. (o)20.0Long. (o)-52.63Alt. (m)Depth (m)4002.69
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012125Metagenome283Y

Sequences

Protein IDFamilyRBSSequence
JGI12001J15744_10122351F012125N/AMSDTRYSVMHPDSGKDSFFSAGKPKNLPRFYFLVLAGIFLMIFMFLW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.