Scaffold JGI12074J15755_1002762

Overview

Basic Information

• Taxon OID: 3300001584
• Scaffold ID: JGI12074J15755_1002762
• Source Dataset Name: Marine microbial communities from the Deep Pacific Ocean - MP2097
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1409
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: North Pacific Ocean
• Coordinates
  • Lat. (^o): 14.53
  • Long. (^o): -118.77
  • Depth (m): 294

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077905	Metagenome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12074J15755_10027623	F077905	N/A	TDFYRFLPIFRTFLGDFNPQKLPSRGLRTLWEWKNRVLLEEYYIFNVAIPLEVQREQSYETQ*