Scaffold JGI11757J15750_1001562

Overview

Basic Information

• Taxon OID: 3300001581
• Scaffold ID: JGI11757J15750_1001562
• Source Dataset Name: Marine microbial communities from the Deep Atlantic Ocean - MP0759
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3510
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: West of Cape Town, South Africa, South Atlantic Ocean
• Coordinates
  • Lat. (^o): -32.81
  • Long. (^o): 12.77
  • Depth (m): 3901.64

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027993	Metagenome	193	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI11757J15750_10015625	F027993	N/A	MIAKAASKQVAELTKAAKTKPNLRPILPIIFAAKIVKIAVPTTDKAVGNVDKDFIEVICDPXIPLKKTVIXXAVNPKT*