Scaffold JGI11834J15748_1008178

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI11834J15748_1008178

Scaffold JGI11834J15748_1008178

Overview

Basic Information
Taxon OID	3300001579 Open in IMG/M
Scaffold ID	JGI11834J15748_1008178 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Deep Atlantic Ocean - MP0740
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	744
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	South Atlantic Ocean
Coordinates	Lat. (^o)	-31.81	Long. (^o)	6.84	Alt. (m)		Depth (m)	4001.3
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035075	Metagenome / Metatranscriptome	173	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI11834J15748_10081781	F035075	N/A	LICFFNNAISNKYVNKIIKLRRLWGIQKNTEAVGKWDPKKEELEKKIRKNSX

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.