Basic Information | |
---|---|
Taxon OID | 3300001570 Open in IMG/M |
Scaffold ID | JGI12211J15759_103613 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Deep Pacific Ocean - MP2016 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1137 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | East of Hawaii, North Pacific Ocean | |||||||
Coordinates | Lat. (o) | 18.04 | Long. (o) | -133.26 | Alt. (m) | Depth (m) | 4004.03 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F069480 | Metagenome | 124 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI12211J15759_1036132 | F069480 | N/A | MRPMPNHIELIDRIYILESRNNIKRVEGNAGQILDQAPKNKPYNTVKTVFFSVFKPVVFL |
⦗Top⦘ |