NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12211J15759_101086

Scaffold JGI12211J15759_101086


Overview

Basic Information
Taxon OID3300001570 Open in IMG/M
Scaffold IDJGI12211J15759_101086 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Pacific Ocean - MP2016
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2057
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameEast of Hawaii, North Pacific Ocean
CoordinatesLat. (o)18.04Long. (o)-133.26Alt. (m)Depth (m)4004.03
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041257Metagenome / Metatranscriptome160N

Sequences

Protein IDFamilyRBSSequence
JGI12211J15759_1010861F041257N/AFDHERFKTLTVLAHAAGRVMDRYAIKGFDGFTNRQADWACKLQSFFNLSNTFETLVLLLFTFQFSQNERFDLEMGKTEPIDRSHPLSQALMAWVWWDPSSETSRVDRFYPWEYGEERTIRMVAIASGLLPEPIDVTSPSDVPPSPPRTQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.