Scaffold JGI12211J15759_101086

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI12211J15759_101086

Scaffold JGI12211J15759_101086

Overview

Basic Information
Taxon OID	3300001570 Open in IMG/M
Scaffold ID	JGI12211J15759_101086 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Deep Pacific Ocean - MP2016
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2057
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	East of Hawaii, North Pacific Ocean
Coordinates	Lat. (^o)	18.04	Long. (^o)	-133.26	Alt. (m)		Depth (m)	4004.03
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041257	Metagenome / Metatranscriptome	160	N

Sequences

Protein ID	Family	RBS	Sequence
JGI12211J15759_1010861	F041257	N/A	FDHERFKTLTVLAHAAGRVMDRYAIKGFDGFTNRQADWACKLQSFFNLSNTFETLVLLLFTFQFSQNERFDLEMGKTEPIDRSHPLSQALMAWVWWDPSSETSRVDRFYPWEYGEERTIRMVAIASGLLPEPIDVTSPSDVPPSPPRTQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.