Scaffold JGI12090J15751_1015995

Overview

Basic Information

• Taxon OID: 3300001569
• Scaffold ID: JGI12090J15751_1015995
• Source Dataset Name: Marine microbial communities from the Deep Indian Ocean - MP0960
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1094
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: East of Madagascar, South Indian Ocean
• Coordinates
  • Lat. (^o): -27.98
  • Long. (^o): 63.25
  • Depth (m): 3504.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032684	Metagenome / Metatranscriptome	179	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12090J15751_10159951	F032684	N/A	MRLLCTLRVLALIDKFKSNFSLFKAEEVIFLPFGIITKNTLKNIIQPKITPTDKNANLDPKIFAKQNEI