Basic Information | |
---|---|
Taxon OID | 3300001569 Open in IMG/M |
Scaffold ID | JGI12090J15751_1015995 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Deep Indian Ocean - MP0960 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1094 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | East of Madagascar, South Indian Ocean | |||||||
Coordinates | Lat. (o) | -27.98 | Long. (o) | 63.25 | Alt. (m) | Depth (m) | 3504.69 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032684 | Metagenome / Metatranscriptome | 179 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI12090J15751_10159951 | F032684 | N/A | MRLLCTLRVLALIDKFKSNFSLFKAEEVIFLPFGIITKNTLKNIIQPKITPTDKNANLDPKIFAKQNEI |
⦗Top⦘ |