Scaffold ShallowMG2_10003

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ShallowMG2_10003

Scaffold ShallowMG2_10003

Overview

Basic Information
Taxon OID	3300001554 Open in IMG/M
Scaffold ID	ShallowMG2_10003 Open in IMG/M
Source Dataset Name	Hydrothermal vent plume microbial communities from the Cayman RIse, Caribbean Sea - Cayman Shallow_MG2b
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	53475
Total Scaffold Genes	48 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	26 (54.17%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Caribbean Sea

Source Dataset Sampling Location
Location Name	Von Damm hydrothermal vent, Caribbean Sea
Coordinates	Lat. (^o)	18.3763	Long. (^o)	-81.7891	Alt. (m)		Depth (m)	2000
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005684	Metagenome / Metatranscriptome	393	Y

Sequences

Protein ID	Family	RBS	Sequence
ShallowMG2_100039	F005684	AGGAGG	VYDTEESPLSTMQVVRRESEVREGRLCNRNEPRQAHCEPERGRFPDRGWNEHPRRSKSKQVRMASTGPGRMHS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.