3300001554: Hydrothermal vent plume microbial communities from the Cayman RIse, Caribbean Sea - Cayman Shallow_MG2b

Overview

Basic Information

• IMG/M Taxon OID: 3300001554
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0092916 | Gp0055725 | Ga0012534
• Sample Name: Hydrothermal vent plume microbial communities from the Cayman RIse, Caribbean Sea - Cayman Shallow_MG2b
• Sequencing Status: Permanent Draft
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 2854089
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Archaea → Euryarchaeota	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Caribbean Sea
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Caribbean Sea

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal plume → hydrothermal fluid
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Location: Von Damm hydrothermal vent, Caribbean Sea
• Coordinates
  • Lat. (^o): 18.3763
  • Long. (^o): -81.7891
  • Alt. (m): N/A
  • Depth (m): 2000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005684	Metagenome / Metatranscriptome	393	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
ShallowMG2_10003	All Organisms → cellular organisms → Archaea → Euryarchaeota	53475

Sequences

Scaffold ID	Protein ID	Family	Sequence
ShallowMG2_10003	ShallowMG2_100039	F005684	VYDTEESPLSTMQVVRRESEVREGRLCNRNEPRQAHCEPERGRFPDRGWNEHPRRSKSKQVRMASTGPGRMHS*