Scaffold A1565W1_10079006

Overview

Basic Information

• Taxon OID: 3300001536
• Scaffold ID: A1565W1_10079006
• Source Dataset Name: Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-65cm-8A)- 1 week illumina
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Tennessee
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 509
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost → Permafrost And Active Layer Microbial Communities From Mcgill Arctic Research Station (Mars)

Source Dataset Sampling Location

• Location Name: Axel Heiberg Island, Nunavut, Canada
• Coordinates
  • Lat. (^o): 79.26
  • Long. (^o): -90.46

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064545	Metagenome / Metatranscriptome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
A1565W1_100790061	F064545	N/A	VRVYALTSSQVAGETLDLFLTRGAAEAELREILEDEPGWASILSVVPIELDERDVSAN