Scaffold MLSed_10105513

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold MLSed_10105513

Scaffold MLSed_10105513

Overview

Basic Information
Taxon OID	3300001533 Open in IMG/M
Scaffold ID	MLSed_10105513 Open in IMG/M
Source Dataset Name	Benthic freshwater microbial communities from British Columbia, Canada
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1303
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic → Benthic Freshwater Sediment Microbial Communities From British Columbia, Canada

Source Dataset Sampling Location
Location Name	British Columbia, Canada
Coordinates	Lat. (^o)	49.283333	Long. (^o)	-119.583333	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078366	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
MLSed_101055132	F078366	N/A	DGGHPSWGPIPDGSFLITAEVAANMLAQNGSYAFSEFDGFPVQKLPDYGFDYL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.