NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold chfe1id_10033279

Scaffold chfe1id_10033279


Overview

Basic Information
Taxon OID3300001528 Open in IMG/M
Scaffold IDchfe1id_10033279 Open in IMG/M
Source Dataset NameVirome of Chimps sample 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1954
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Primate Fecal → Primate Fecal Viral Communities From Gombe National Park, Tanzania

Source Dataset Sampling Location
Location NameGombe National Park, Tanzania
CoordinatesLat. (o)-4.4Long. (o)29.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026592Metagenome / Metatranscriptome197Y

Sequences

Protein IDFamilyRBSSequence
chfe1id_100332792F026592N/ATASPQGIDAQASQGSVAPLTERSDEAFLVMQFSSADGE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.