| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001528 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0095260 | Gp0056250 | Ga0012982 |
| Sample Name | Virome of Chimps sample 1 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 448696896 |
| Sequencing Scaffolds | 8 |
| Novel Protein Genes | 8 |
| Associated Families | 8 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2 |
| All Organisms → Viruses → unclassified bacterial viruses → virus sp. ct6GG30 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Primate Fecal Viral Communities From Gombe National Park, Tanzania |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Primate Fecal → Primate Fecal Viral Communities From Gombe National Park, Tanzania |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Gombe National Park, Tanzania | |||||||
| Coordinates | Lat. (o) | -4.4 | Long. (o) | 29.38 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F026592 | Metagenome / Metatranscriptome | 197 | Y |
| F032286 | Metagenome / Metatranscriptome | 180 | Y |
| F036964 | Metagenome / Metatranscriptome | 169 | Y |
| F052660 | Metagenome | 142 | N |
| F062845 | Metagenome | 130 | N |
| F067720 | Metagenome | 125 | Y |
| F084822 | Metagenome | 112 | Y |
| F092227 | Metagenome | 107 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| chfe1id_10003649 | Not Available | 10811 | Open in IMG/M |
| chfe1id_10006391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae | 6388 | Open in IMG/M |
| chfe1id_10025691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2353 | Open in IMG/M |
| chfe1id_10033279 | Not Available | 1954 | Open in IMG/M |
| chfe1id_10059743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 2262 | Open in IMG/M |
| chfe1id_10066990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1174 | Open in IMG/M |
| chfe1id_10104187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 852 | Open in IMG/M |
| chfe1id_10194357 | All Organisms → Viruses → unclassified bacterial viruses → virus sp. ct6GG30 | 538 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| chfe1id_10003649 | chfe1id_100036499 | F036964 | MQILKLIFPALMVAGALGSLVVNILSKGDRATSLQWLGAMILYTALMLRNYK* |
| chfe1id_10006391 | chfe1id_100063916 | F052660 | MCILRVLPENTPEKIGQERAGTEWTVVKSKIRLCIRNCSYGQFLHGGILMGIALPIPSYRAKSHDFACWWTAAAGHSRSANALPGKSNP* |
| chfe1id_10025691 | chfe1id_100256912 | F084822 | MANYEENMYNWLKRKGFAEKYEHAGIYCIKIDQKIVYIGKSTNMLRRVS* |
| chfe1id_10033279 | chfe1id_100332792 | F026592 | TASPQGIDAQASQGSVAPLTERSDEAFLVMQFSSADGE* |
| chfe1id_10059743 | chfe1id_100597432 | F062845 | MEKTPFILHEKFRSDDSEQRKEHFQKEFERYIVDGLSNTAPSKSCV* |
| chfe1id_10066990 | chfe1id_100669902 | F032286 | VTPVRRRALVFDARLFVGNAADDALVTGGTFRFCRLMCLCVKRRNIILNGKCRSLFDSALFRADNRTGQKTISPFSLALFFTFDFAALSERRSCPGLSPRRFVLLGALDAALRRRTYPVRTVMQFSRFRCDCKTILAKKHALSRISKR* |
| chfe1id_10104187 | chfe1id_101041872 | F092227 | MNEEKRKRFLRIGCLLLAGVFLLSVLGSVVLMLLA* |
| chfe1id_10194357 | chfe1id_101943571 | F067720 | MASTTYEHFVDTNKMYAVQEQFRHVTKMVCDFVKINKIDLFAALGNMARNAGQLPQPFWLGAACGGGSRSAAPCAART* |
| ⦗Top⦘ |