Basic Information | |
---|---|
Taxon OID | 3300001525 Open in IMG/M |
Scaffold ID | chfec4_10000407 Open in IMG/M |
Source Dataset Name | Chimp virome sample 4 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 29586 |
Total Scaffold Genes | 37 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 32 (86.49%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Primate Fecal → Primate Fecal Viral Communities From Gombe National Park, Tanzania |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gombe National Park, Tanzania | |||||||
Coordinates | Lat. (o) | -4.4 | Long. (o) | 29.38 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F092227 | Metagenome | 107 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
chfec4_1000040726 | F092227 | AGGAGG | MNEQKRKRILRVGCLLLAGVFLLSVLGSVILMLLV* |
⦗Top⦘ |