Scaffold JGI12186J15620_100053

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI12186J15620_100053

Scaffold JGI12186J15620_100053

Overview

Basic Information
Taxon OID	3300001490 Open in IMG/M
Scaffold ID	JGI12186J15620_100053 Open in IMG/M
Source Dataset Name	Fosmid Clones Derived from Amazon Forest Soil Microbial Communities
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	30303
Total Scaffold Genes	39 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	31 (79.49%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Forest Soil → Forest Soil Microbial Communities From The Amazon Forest, Brazil, Of Fosmid Clones

Source Dataset Sampling Location
Location Name	Moj? ? PA (north of Brazil).
Coordinates	Lat. (^o)	-2.5871	Long. (^o)	-49.041	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056963	Metagenome	137	N

Sequences

Protein ID	Family	RBS	Sequence
JGI12186J15620_1000533	F056963	AGGA	LFSLFEAVAQGLAALRKNEWVEGIEERFGVVKVSVTDVRVEHQVKIADLMKWLERPGRTPREVTHRLRIRAILGMSVSR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.