3300001490: Fosmid Clones Derived from Amazon Forest Soil Microbial Communities

Overview

Basic Information

• IMG/M Taxon OID: 3300001490
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0071049 | Gp0054693 | Ga0026097
• Sample Name: Fosmid Clones Derived from Amazon Forest Soil Microbial Communities
• Sequencing Status: Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 3532881
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Forest Soil Microbial Communities From The Amazon Forest, Brazil, Of Fosmid Clones
• Type: Environmental
• Taxonomy: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Forest Soil → Forest Soil Microbial Communities From The Amazon Forest, Brazil, Of Fosmid Clones

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): forest biome → land → forest soil
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline)

Location Information

• Location: Moj? ? PA (north of Brazil).
• Coordinates
  • Lat. (^o): -2.5871
  • Long. (^o): -49.041
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026670	Metagenome / Metatranscriptome	197	Y
F056963	Metagenome	137	N

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI12186J15620_100053	All Organisms → cellular organisms → Bacteria	30303
JGI12186J15620_100352	All Organisms → cellular organisms → Bacteria	571

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12186J15620_100053	JGI12186J15620_1000533	F056963	LFSLFEAVAQGLAALRKNEWVEGIEERFGVVKVSVTDVRVEHQVKIADLMKWLERPGRTPREVTHRLRIRAILGMSVSR*
JGI12186J15620_100352	JGI12186J15620_1003522	F026670	ALLIILALAALITLLGSAFPLRQAAQYDPAPILRGE*