Scaffold JGI24003J15210_10169257

Overview

Basic Information

• Taxon OID: 3300001460
• Scaffold ID: JGI24003J15210_10169257
• Source Dataset Name: Marine viral communities from the Pacific Ocean - LP-28
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 540
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Natronocella → Natronocella acetinitrilica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 48.9699
  • Long. (^o): -130.6666

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079942	Metagenome	115	N

Sequences

Protein ID	Family	RBS	Sequence
JGI24003J15210_101692573	F079942	N/A	EFYGTIADVNVYKNEPKNLKTISEDEGQRCFELEIKDSNNE*