Scaffold MCRcombined_1023359

Overview

Basic Information

• Taxon OID: 3300001458
• Scaffold ID: MCRcombined_1023359
• Source Dataset Name: Hydrothermal vent plume microbial communities from the Mid Cayman Rise - All Sites - gte1k
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4381
• Total Scaffold Genes: 14
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 9 (64.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → unclassified Nitrososphaerales → Nitrososphaerales archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Cayman Islands

Source Dataset Sampling Location

• Location Name: Mid Cayman Rise, Cayman Islands, United Kingdom
• Coordinates
  • Lat. (^o): 18.35
  • Long. (^o): -81.85
  • Depth (m): 2000 to 4000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003827	Metagenome / Metatranscriptome	466	Y

Sequences

Protein ID	Family	RBS	Sequence
MCRcombined_10233591	F003827	AGGAG	VAEGRWADWQVRTIAENMAEKRPKREWFEGDGHGEDYLTSLKSWSHITARQLYSMELEERQLIIFVHHLGIEHVGIETFDPQDKGRYAQQSDYAPSEGDTYNTPRLDIAGSE*