Scaffold yes_14990577

Overview

Basic Information

• Taxon OID: 3300001451
• Scaffold ID: yes_14990577
• Source Dataset Name: Goat rumen bacterial communities from Langston, Oklahoma, USA - velvet Assemble
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Cornell University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1090
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → unclassified Rikenellaceae → Rikenellaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Goat Rumen → Goat Rumen Microbial Communities From Langston University, Oklahoma, Usa

Source Dataset Sampling Location

• Location Name: Langston, Oklahoma, USA
• Coordinates
  • Lat. (^o): 35.453976
  • Long. (^o): -97.515884

Associated Families

Family	Category	Number of Sequences	3D Structure?
F106163	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
yes_149905772	F106163	N/A	MKRLLIICLGLLLLAGCKEKRYFKEIPGDNWLCQIGFDDGSKREFWVVSDVLYAGEDSTSRFKMVFYMPDGWDDSYPVFLDRYVPENDYVSAYTAYQGMPVAEDALKMGNMIVVLVAYNEWTAIPDILLAEHFLKEHDDDIPGDSRNILTAADFDFEPVVEIE*