Scaffold yes_10810107

Overview

Basic Information

• Taxon OID: 3300001451
• Scaffold ID: yes_10810107
• Source Dataset Name: Goat rumen bacterial communities from Langston, Oklahoma, USA - velvet Assemble
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Cornell University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2956
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → unclassified Prevotella → Prevotella sp. BP1-148 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Foregut → Rumen → Goat Rumen → Goat Rumen Microbial Communities From Langston University, Oklahoma, Usa

Source Dataset Sampling Location

• Location Name: Langston, Oklahoma, USA
• Coordinates
  • Lat. (^o): 35.453976
  • Long. (^o): -97.515884

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059440	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
yes_108101075	F059440	AGGAG	MNRKEREAEFRAKIAKLDAYVEEMNAKGNLTNEEWGEVWSAMLQTNRYLRAIGAPESEMYDI*