| Basic Information | |
|---|---|
| Taxon OID | 3300001422 Open in IMG/M |
| Scaffold ID | Draft_100759 Open in IMG/M |
| Source Dataset Name | Oil sands microbial communities from Horse River, Alberta, Canada - outcrops |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McGill University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4791 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Sand → Oil-Contaminated → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Horse River, Fort McMurray, Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 56.70268 | Long. (o) | -111.398858 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009302 | Metagenome / Metatranscriptome | 320 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Draft_1007591 | F009302 | GGAG | VRMTTAPQTVEPTWVCDECAGEGQLAYDPEATMWVPRSATADWPADDSIAISVLDCLQCDGTGTMRLDPADGNRPTRSAR* |
| ⦗Top⦘ |