Basic Information | |
---|---|
Taxon OID | 3300001395 Open in IMG/M |
Scaffold ID | yes_11423168 Open in IMG/M |
Source Dataset Name | Goat rumen fungal communities from Langston, Oklahoma, USA - velvetAssemble |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Cornell University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 740 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Goat Rumen → Goat Rumen Microbial Communities From Langston University, Oklahoma, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Langston, Oklahoma, USA | |||||||
Coordinates | Lat. (o) | 35.453976 | Long. (o) | -97.515884 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F106163 | Metagenome | 100 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
yes_114231681 | F106163 | N/A | MKRLLYLLPLALLLLAGCKEKGSFSNVEIGESWLCRLVFEDESFKDYVVTADVLYAGEDTSSRYKMVFYMPEGWDNSYPIFLDRYVPCDGPAWQAYQGMPVAEDALKEGNMIVVLVAYSEWTAIPDILLAEAFLKQHDADLPGDSRNILTAADFDFETAAYYDFE* |
⦗Top⦘ |