NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold yes_10089088

Scaffold yes_10089088


Overview

Basic Information
Taxon OID3300001395 Open in IMG/M
Scaffold IDyes_10089088 Open in IMG/M
Source Dataset NameGoat rumen fungal communities from Langston, Oklahoma, USA - velvetAssemble
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCornell University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4464
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (12.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Goat Rumen → Goat Rumen Microbial Communities From Langston University, Oklahoma, Usa

Source Dataset Sampling Location
Location NameLangston, Oklahoma, USA
CoordinatesLat. (o)35.453976Long. (o)-97.515884Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F058536Metagenome135Y

Sequences

Protein IDFamilyRBSSequence
yes_100890882F058536GGAMKTLALSELRRVAERTQMVTRKIPDEQGGFQMVQVQERIPWRVWYVAASNGDCIRGDECVTLSVELNGPGAYPSRLVQFTASGQTRRLRDVCILQANDFRLVL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.