| Basic Information | |
|---|---|
| Taxon OID | 3300001390 Open in IMG/M |
| Scaffold ID | SMAR1_101000 Open in IMG/M |
| Source Dataset Name | SMAR1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2861 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From The Southwest Indian Ridge |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F030933 | Metagenome / Metatranscriptome | 184 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| SMAR1_1010002 | F030933 | AGG | MMSDDPQSREQQRKQARAIKTAWVLGFIALAIFATFIGSAVMGH* |
| ⦗Top⦘ |