3300001390: SMAR1

Overview

Basic Information

• IMG/M Taxon OID: 3300001390
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0090378 | Gp0055595 | Ga0012452
• Sample Name: SMAR1
• Sequencing Status: Permanent Draft
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 25572676
• Sequencing Scaffolds: 2
• Novel Protein Genes: 2
• Associated Families: 2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	1
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Hydrothermal Vent Microbial Communities From The Southwest Indian Ridge
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Hydrothermal Vent Microbial Communities From The Southwest Indian Ridge

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Subsurface (non-saline)

Location Information

• Coordinates
  • Lat. (^o): N/A
  • Long. (^o): N/A
  • Alt. (m): N/A
  • Depth (m): N/A

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030933	Metagenome / Metatranscriptome	184	Y
F072876	Metagenome	121	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
SMAR1_101000	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	2861
SMAR1_102086	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18	2026

Sequences

Scaffold ID	Protein ID	Family	Sequence
SMAR1_101000	SMAR1_1010002	F030933	MMSDDPQSREQQRKQARAIKTAWVLGFIALAIFATFIGSAVMGH*
SMAR1_102086	SMAR1_1020864	F072876	MELSKQSYLQILEMPIQRFYNYLKWKTELEEEKRKLMEEKTSNG*