| Basic Information | |
|---|---|
| Taxon OID | 3300001389 Open in IMG/M |
| Scaffold ID | BDMCk91_101539 Open in IMG/M |
| Source Dataset Name | Benzene-degrading bioreactor methanogenic microbial communities from Toronto, Canada - k91 assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3105 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Bioremediation → Hydrocarbon → Benzene → Bioreactor → Benzene-Degrading Bioreactor Methanogenic → Benzene-Degrading Bioreactor Methanogenic Microbial Communities From Toronto, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Toronto, Canada | |||||||
| Coordinates | Lat. (o) | 43.66266 | Long. (o) | -79.3917 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050029 | Metagenome / Metatranscriptome | 146 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BDMCk91_1015396 | F050029 | AGGAGG | MATILIHWKDKNLPAMEIKDAAYKGADSSIIKITSNGNEYWFNWNECWFLETTSTNDIPI |
| ⦗Top⦘ |