| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001389 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0090635 | Gp0052049 | Ga0012451 |
| Sample Name | Benzene-degrading bioreactor methanogenic microbial communities from Toronto, Canada - k91 assembly |
| Sequencing Status | Permanent Draft |
| Sequencing Center | |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 9042418 |
| Sequencing Scaffolds | 1 |
| Novel Protein Genes | 1 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Benzene-Degrading Bioreactor Methanogenic Microbial Communities From Toronto, Canada |
| Type | Engineered |
| Taxonomy | Engineered → Bioremediation → Hydrocarbon → Benzene → Bioreactor → Benzene-Degrading Bioreactor Methanogenic → Benzene-Degrading Bioreactor Methanogenic Microbial Communities From Toronto, Canada |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | na → na → na |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Toronto, Canada | |||||||
| Coordinates | Lat. (o) | 43.66266 | Long. (o) | -79.3917 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F050029 | Metagenome / Metatranscriptome | 146 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| BDMCk91_101539 | All Organisms → cellular organisms → Bacteria | 3105 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| BDMCk91_101539 | BDMCk91_1015396 | F050029 | MATILIHWKDKNLPAMEIKDAAYKGADSSIIKITSNGNEYWFNWNECWFLETTSTNDIPI |
| ⦗Top⦘ |