Scaffold YBBDRAFT_1183212

Overview

Basic Information

• Taxon OID: 3300001372
• Scaffold ID: YBBDRAFT_1183212
• Source Dataset Name: YB-Back-sed
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of South Carolina
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 769
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location

• Location Name: Youngs Bay mouth
• Coordinates
  • Lat. (^o): 46.15968
  • Long. (^o): -123.80651
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091050	Metagenome / Metatranscriptome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
YBBDRAFT_11832122	F091050	GGAG	MTFAEVLDWCKKQKANVRGLSRGMEIPISYKDQQLPANLPPMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG*