NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F091050

Metagenome / Metatranscriptome Family F091050

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091050
Family Type Metagenome / Metatranscriptome
Number of Sequences 108
Average Sequence Length 84 residues
Representative Sequence MTFAEVLDWCKKQKANVRALGRGMEIPISYKDQQLPANLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG
Number of Associated Samples 94
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 87.96 %
% of genes near scaffold ends (potentially truncated) 22.22 %
% of genes from short scaffolds (< 2000 bps) 81.48 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction Yes
3D model pTM-score0.81

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.074 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(24.074 % of family members)
Environment Ontology (ENVO) Unclassified
(38.889 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(35.185 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.66%    β-sheet: 22.12%    Coil/Unstructured: 52.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.81
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
d.193.1.1: Hsp33 domaind1hw7a_1hw70.56306
b.3.6.1: Aromatic compound dioxygenased4whsa_4whs0.55567
b.7.1.2: Synaptotagmin-like (S variant)d1wfma11wfm0.54151
b.25.1.0: automated matchesd3zs3a_3zs30.54134
b.7.1.1: PLC-like (P variant)d1qasa21qas0.53077


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF07883Cupin_2 37.04
PF01738DLH 20.37
PF00106adh_short 2.78
PF04321RmlD_sub_bind 1.85
PF00254FKBP_C 1.85
PF09084NMT1 0.93
PF16363GDP_Man_Dehyd 0.93
PF07690MFS_1 0.93
PF13416SBP_bac_8 0.93
PF00483NTP_transferase 0.93
PF13343SBP_bac_6 0.93
PF02423OCD_Mu_crystall 0.93
PF01476LysM 0.93
PF13185GAF_2 0.93
PF00999Na_H_Exchanger 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 108 Family Scaffolds
COG0451Nucleoside-diphosphate-sugar epimeraseCell wall/membrane/envelope biogenesis [M] 3.70
COG0702Uncharacterized conserved protein YbjT, contains NAD(P)-binding and DUF2867 domainsGeneral function prediction only [R] 3.70
COG1086NDP-sugar epimerase, includes UDP-GlcNAc-inverting 4,6-dehydratase FlaA1 and capsular polysaccharide biosynthesis protein EpsCCell wall/membrane/envelope biogenesis [M] 3.70
COG1087UDP-glucose 4-epimeraseCell wall/membrane/envelope biogenesis [M] 1.85
COG1088dTDP-D-glucose 4,6-dehydrataseCell wall/membrane/envelope biogenesis [M] 1.85
COG1089GDP-D-mannose dehydrataseCell wall/membrane/envelope biogenesis [M] 1.85
COG1090NAD dependent epimerase/dehydratase family enzymeGeneral function prediction only [R] 1.85
COG1091dTDP-4-dehydrorhamnose reductaseCell wall/membrane/envelope biogenesis [M] 1.85
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 0.93
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 0.93
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.93
COG2423Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin familyAmino acid transport and metabolism [E] 0.93
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 0.93
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 0.93
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.93
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.07 %
UnclassifiedrootN/A0.93 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_104646688All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium838Open in IMG/M
3300000559|F14TC_101273753All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium710Open in IMG/M
3300000956|JGI10216J12902_102242824All Organisms → cellular organisms → Bacteria2266Open in IMG/M
3300000956|JGI10216J12902_106821512All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium924Open in IMG/M
3300001372|YBBDRAFT_1183212All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium769Open in IMG/M
3300002907|JGI25613J43889_10062268All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1023Open in IMG/M
3300004011|Ga0055460_10195340All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium627Open in IMG/M
3300004050|Ga0055491_10156293All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium600Open in IMG/M
3300004051|Ga0055492_10018593All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1170Open in IMG/M
3300004145|Ga0055489_10307020All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium510Open in IMG/M
3300004778|Ga0062383_10150204All Organisms → cellular organisms → Bacteria1043Open in IMG/M
3300004778|Ga0062383_10699859All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium518Open in IMG/M
3300004778|Ga0062383_10703129All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria517Open in IMG/M
3300004782|Ga0062382_10013929All Organisms → cellular organisms → Bacteria2502Open in IMG/M
3300005164|Ga0066815_10022038All Organisms → cellular organisms → Bacteria898Open in IMG/M
3300005830|Ga0074473_10690247All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1101Open in IMG/M
3300005836|Ga0074470_10165525All Organisms → cellular organisms → Bacteria2140Open in IMG/M
3300005836|Ga0074470_10994784All Organisms → cellular organisms → Bacteria4642Open in IMG/M
3300006224|Ga0079037_100820205All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium914Open in IMG/M
3300006865|Ga0073934_10001388All Organisms → cellular organisms → Bacteria58800Open in IMG/M
3300006930|Ga0079303_10396002All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria584Open in IMG/M
3300007004|Ga0079218_12710147All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium592Open in IMG/M
3300009053|Ga0105095_10037259All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2617Open in IMG/M
3300009078|Ga0105106_10062462All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2745Open in IMG/M
3300009087|Ga0105107_10104433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1997Open in IMG/M
3300009087|Ga0105107_10685201All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium713Open in IMG/M
3300009091|Ga0102851_13013915All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium541Open in IMG/M
3300009166|Ga0105100_10174169All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1279Open in IMG/M
3300009609|Ga0105347_1007717All Organisms → cellular organisms → Bacteria3769Open in IMG/M
3300009609|Ga0105347_1023352All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2135Open in IMG/M
3300009678|Ga0105252_10105970All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1134Open in IMG/M
3300009789|Ga0126307_10807269All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium757Open in IMG/M
3300010036|Ga0126305_10088321All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1840Open in IMG/M
3300011403|Ga0137313_1094613All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium540Open in IMG/M
3300011406|Ga0137454_1049518All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium668Open in IMG/M
3300011414|Ga0137442_1127297All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300011417|Ga0137326_1121649All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium602Open in IMG/M
3300011421|Ga0137462_1187287All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium513Open in IMG/M
3300011427|Ga0137448_1007124All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2250Open in IMG/M
3300011428|Ga0137456_1163228All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria599Open in IMG/M
3300011429|Ga0137455_1075220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium973Open in IMG/M
3300011435|Ga0137426_1035126All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1272Open in IMG/M
3300011435|Ga0137426_1273252All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300011438|Ga0137451_1059226All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1129Open in IMG/M
3300011441|Ga0137452_1321422All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria515Open in IMG/M
3300011442|Ga0137437_1333289All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium515Open in IMG/M
3300012035|Ga0137445_1077615All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium667Open in IMG/M
3300012041|Ga0137430_1240851All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium516Open in IMG/M
3300012137|Ga0137346_1027324All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria726Open in IMG/M
3300012143|Ga0137354_1032638All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium809Open in IMG/M
3300012160|Ga0137349_1013136All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1240Open in IMG/M
3300012226|Ga0137447_1105416All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium562Open in IMG/M
3300012960|Ga0164301_11622523All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium537Open in IMG/M
3300014305|Ga0075349_1172611Not Available517Open in IMG/M
3300014315|Ga0075350_1008890All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1729Open in IMG/M
3300014861|Ga0180061_1014120All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1133Open in IMG/M
3300014864|Ga0180068_1038773All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium765Open in IMG/M
3300014870|Ga0180080_1051183All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria683Open in IMG/M
3300015252|Ga0180075_1022219All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium908Open in IMG/M
3300017939|Ga0187775_10265220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium664Open in IMG/M
3300018029|Ga0187787_10055895All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1177Open in IMG/M
3300018083|Ga0184628_10001494All Organisms → cellular organisms → Bacteria11567Open in IMG/M
3300018084|Ga0184629_10291904All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium857Open in IMG/M
3300018084|Ga0184629_10494262All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium638Open in IMG/M
3300018422|Ga0190265_10125618All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2461Open in IMG/M
3300018429|Ga0190272_10299198All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1245Open in IMG/M
3300018429|Ga0190272_11648405All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium661Open in IMG/M
3300018432|Ga0190275_10630857All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1122Open in IMG/M
3300018432|Ga0190275_11042094All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria890Open in IMG/M
3300018466|Ga0190268_10026026All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1996Open in IMG/M
3300018920|Ga0190273_10393281All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium972Open in IMG/M
3300018920|Ga0190273_12429904All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria500Open in IMG/M
3300019228|Ga0180119_1171472All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium739Open in IMG/M
3300019229|Ga0180116_1303990All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium699Open in IMG/M
3300019248|Ga0180117_1390338All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium724Open in IMG/M
3300019257|Ga0180115_1267712All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium654Open in IMG/M
3300019356|Ga0173481_10717465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium542Open in IMG/M
3300020064|Ga0180107_1003500All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium744Open in IMG/M
3300020186|Ga0163153_10042592All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3204Open in IMG/M
3300020195|Ga0163150_10084705All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2084Open in IMG/M
3300022214|Ga0224505_10089868All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1214Open in IMG/M
3300022309|Ga0224510_10135710All Organisms → cellular organisms → Bacteria → Proteobacteria1439Open in IMG/M
3300025310|Ga0209172_10003097All Organisms → cellular organisms → Bacteria → Proteobacteria26657Open in IMG/M
3300025562|Ga0210099_1035341All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium958Open in IMG/M
3300025951|Ga0210066_1056786All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium667Open in IMG/M
3300026320|Ga0209131_1110963All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1433Open in IMG/M
3300026485|Ga0256805_1040426All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium594Open in IMG/M
3300027778|Ga0209464_10216279All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria686Open in IMG/M
3300027815|Ga0209726_10058470All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2600Open in IMG/M
3300027815|Ga0209726_10238850All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium927Open in IMG/M
3300027815|Ga0209726_10402211All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium637Open in IMG/M
3300027818|Ga0209706_10489072All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium563Open in IMG/M
3300027840|Ga0209683_10006996All Organisms → cellular organisms → Bacteria → Proteobacteria4413Open in IMG/M
3300027840|Ga0209683_10101751All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1299Open in IMG/M
3300027843|Ga0209798_10021808All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium3414Open in IMG/M
3300027979|Ga0209705_10186828All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1093Open in IMG/M
3300028145|Ga0247663_1012462All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1206Open in IMG/M
3300031538|Ga0310888_10496130All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium730Open in IMG/M
3300031548|Ga0307408_100107843All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2133Open in IMG/M
3300031858|Ga0310892_11232888All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium534Open in IMG/M
3300031965|Ga0326597_10006600All Organisms → cellular organisms → Bacteria → Proteobacteria15882Open in IMG/M
3300032144|Ga0315910_11594345All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium509Open in IMG/M
3300032275|Ga0315270_10358592All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium924Open in IMG/M
3300033406|Ga0316604_10674638All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium568Open in IMG/M
3300033408|Ga0316605_10489110All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1131Open in IMG/M
3300033419|Ga0316601_100372884All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1334Open in IMG/M
3300034150|Ga0364933_090078All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria773Open in IMG/M
3300034659|Ga0314780_085219All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium697Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil24.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.11%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment7.41%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment6.48%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands5.56%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment4.63%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater2.78%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)2.78%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.78%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.78%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat1.85%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.85%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.85%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment1.85%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.85%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.85%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.93%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.93%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.93%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001372YB-Back-sedEnvironmentalOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300004011Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004050Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D2EnvironmentalOpen in IMG/M
3300004051Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2EnvironmentalOpen in IMG/M
3300004145Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300006224Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaGEnvironmentalOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006930Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWCEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009053Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009166Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300011403Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT166_2EnvironmentalOpen in IMG/M
3300011406Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2EnvironmentalOpen in IMG/M
3300011414Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2EnvironmentalOpen in IMG/M
3300011417Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT500_2EnvironmentalOpen in IMG/M
3300011421Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2EnvironmentalOpen in IMG/M
3300011427Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT418_2EnvironmentalOpen in IMG/M
3300011428Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012137Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT560_2EnvironmentalOpen in IMG/M
3300012143Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2EnvironmentalOpen in IMG/M
3300012160Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT630_2EnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300014305Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleB_D1EnvironmentalOpen in IMG/M
3300014315Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1EnvironmentalOpen in IMG/M
3300014861Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10DEnvironmentalOpen in IMG/M
3300014864Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231A'_16_10DEnvironmentalOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300015252Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10DEnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019228Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT790_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019229Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019248Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019257Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020064Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT27_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020186Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1EnvironmentalOpen in IMG/M
3300020195Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IBEnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022309Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025562Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025951Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026485Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 F6EnvironmentalOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028145Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300033406Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_CTEnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300033419Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCTEnvironmentalOpen in IMG/M
3300034150Sediment microbial communities from East River floodplain, Colorado, United States - 25_j17EnvironmentalOpen in IMG/M
3300034659Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10464668823300000364SoilMTFAEVLNWCKKHRADVRGIYRGKDIAISHKDSEPPKTLPDMGAIFHWDVEIGDWDHYVSGSDMELMVTGKMTIDEFKSTLRRGE*
F14TC_10127375323300000559SoilNVRALGRGMEIPISYNDQQLPANLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG*
JGI10216J12902_10224282433300000956SoilMTFAEILDWCKKQKANVRGLGRGMEIPISYKDQQLPSDLPPMSKVMHWDLEIGNWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
JGI10216J12902_10682151213300000956SoilMTFAEVLDWCKKQKANVRALGRGMEIPISYNDQQLPANLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG*
YBBDRAFT_118321223300001372Marine EstuarineMTFAEVLDWCKKQKANVRGLSRGMEIPISYKDQQLPANLPPMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG*
JGI25613J43889_1006226813300002907Grasslands SoilMTFAEVLDWCKKHHADVRGIGRGMEIPISYKDQHLPANLPSMNAIMHWDLAIGDWSHYTSGSDMELMVAGKLTVDGFKSTLRGSE*
Ga0055460_1019534023300004011Natural And Restored WetlandsMTFAEVLEWCKKQKADVRGIGRNMEIPISHKDNRLPANLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG*
Ga0055491_1015629313300004050Natural And Restored WetlandsFDWCKKHKADVRAIGRAMEIPISHKDRHLPGDLPPMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDDFKGTLRGGG*
Ga0055492_1001859313300004051Natural And Restored WetlandsMTFAEVFDWCKKHKADVRAIGRAMEIPISHKDRHLPGDLPPMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDDFKGTLRGGG*
Ga0055489_1030702013300004145Natural And Restored WetlandsMTFAEVFDWCKKQKADVRGLGRGMEIPISHKDKELPAELPSMSQIMHWDLEIGDWSHYTSGSDMELMVAGKMTVEQFKGTLRGGG*
Ga0062383_1015020413300004778Wetland SedimentMTFAEVLDWCKKHKADVRALGRGMEIPISHKDNQLPANLPPMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVD
Ga0062383_1069985913300004778Wetland SedimentMTFAEVFDWCKKQKADVRAIGRGMEIPISHKDQQLSANLPPMSQIMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG*
Ga0062383_1070312923300004778Wetland SedimentMTFAEVLEWCKKQKADVRAIGRALEVPISHKDKQLPANLPPISKVMHWDLEIGDWSHYTSGSDMELMVAGKMT
Ga0062382_1001392933300004782Wetland SedimentMTFAEVLEWCKKQKADVRAIGRALEVPISHKDKQLPANLPPISKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKSTLRGGG*
Ga0066815_1002203823300005164SoilMTFAEVLSWCKKHRADVRGIYRGKDIEISHKDSEPPKNLPDMAAIFHWDVEIGDWDHYVSGSDMELMVTGKMTIDEFKSTLRRGE*
Ga0074473_1069024723300005830Sediment (Intertidal)MTFGEVLDWCKKHKANVRGIGRGMEIPISHKDQQLPANLPPMSNIMHWDLEIGDWSHYTSGSDMELMVAGKMTVDDFKGTLRGGG*
Ga0074470_1016552523300005836Sediment (Intertidal)MTFAEVLDWCKKQKANVRGLSRGMEIPISYKDQQLPANLPPMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDEFKSTLRGGG*
Ga0074470_1099478463300005836Sediment (Intertidal)MTFAELLDWCKKQKANVRGLGRGMEIPISYKDQQLPANLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDEFKSTLRGGG*
Ga0079037_10082020513300006224Freshwater WetlandsMTFAEVLEWCKKLKASVRGLGRGMEITISYKDQQLPANLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
Ga0073934_10001388273300006865Hot Spring SedimentMTFAEVLDWCKKQKADVRGIGRHMEVSISHKDQQLPANLPPMSKVLHWNLEIGDWSHYTSGSDMERMVAGKMTLDEFKSTLRRAE*
Ga0079303_1039600213300006930Deep SubsurfaceMTFAEVFDWCKKHKADVRAIGRAMEIPISHKDKQLPGNLPPMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMSVDEFKGTLRGGG*
Ga0079218_1271014723300007004Agricultural SoilMTFAEILDWCKKQKANVRGLGRGMEIPISYKDQQLPGNLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG*
Ga0105095_1003725933300009053Freshwater SedimentMTFAEVFDWCKKQKADVRGIGRGLEIPISHKDPQLPANLPSMSLIMHWDLEIGDWSHYTSGSDMELMVAGKMTVDDFKGTLRGGG*
Ga0105106_1006246223300009078Freshwater SedimentMTFAEVFDWCKKHKADVRAIGRAMEIPISHKDKQLPANLPSMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDEFKGTLRGRG*
Ga0105107_1010443333300009087Freshwater SedimentMTFAEVFDWCKKHKADVRAIGRAMEIPISHKDKQLPANLPSMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDEFKSTLRGGA*
Ga0105107_1068520123300009087Freshwater SedimentMTFAEVFDWCKKQKADVRGIGRGLEIPISHKDPQLPANLPSTGLIMHWDLEIGDWSHYTSGSDMELMVAGKMTVDDFKGTLRGGG*
Ga0102851_1301391513300009091Freshwater WetlandsIQSGQVGKQTSGAAAMTFAEVLDWCKKQKANVRGIGRNMEISISYKDQQLPANLLPMSKIMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG*
Ga0105100_1017416923300009166Freshwater SedimentSIQSGQVGKPTSGAAAMTFAEVFDWCKKHKADVRAIGRAMEIPISHKDKQLPANLPSMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDDFKGTLRGGG*
Ga0105347_100771743300009609SoilMTFAEVFDWCKKQKADVRGIGRAVEIPISHKDQQLPANLPPMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
Ga0105347_102335223300009609SoilMTFAEILDWCKKQKANVRGLGRGMEIPISYKDQQLPAELPPMSKVMHWDLEIGNWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
Ga0105252_1010597023300009678SoilMTFAEILDWCKKQKANVRGLGRGMEIPISYKDQQLPAELPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
Ga0126307_1080726923300009789Serpentine SoilMTFAEVLDWCKKQKANVRALGRGMEIPISYNDQQLPANLPPMTKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG*
Ga0126305_1008832133300010036Serpentine SoilMTFAEVLDWCKKQKANVRALGRGMEIPISYNDQQLPASLPPMTKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG*
Ga0137313_109461313300011403SoilMTFAEVLDWCKKQKASVRGLGRGMEIPISYKDQQLPAELPPMSKVMHWDLEICNWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
Ga0137454_104951823300011406SoilMTFAEVLDWCKKQKADVRAIGRAMEIPISHKDKELPAKLPPISQVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
Ga0137442_112729723300011414SoilMTFAEVLDWCKKHHADVRGIGRGMAIPISHKDQQLPANLPSMNAIMHWNLAIGDWSHYTSGSDMELMVAGKLTADGFKSTLRGSE*
Ga0137326_112164923300011417SoilMTFAEVLDWCKKQKANVRGLGRGMEIPISYKDQQLPANLPPMSKVMHWDLEIGGWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
Ga0137462_118728713300011421SoilEQTSGAAIMTFAEILDWCKKQKANVRGLGRGMEIPISYRDQQLPADLPPMSKVMHWDLEIGNWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
Ga0137448_100712423300011427SoilMTFAEVIDWCKKHQADVRGIGRGMEIPISHKDKQLPANLPTMSAIMHWDLEIGDWSHYTSGSDMELMVAGKMTVDEFKSTLRGAG*
Ga0137456_116322823300011428SoilMTFAEVLDWCKKQKANVRGLGRGMEIPISYKDQQLPAELPPMSKVMHWDLEIGNWSHYTSGSDMELMVAGKMTV
Ga0137455_107522023300011429SoilMTFAEVLDWCKKQKANVRGLGRGMEIPISYKDRQLPVNLPPMSKVMHWDLEIGNWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
Ga0137426_103512623300011435SoilMTFAEVFDWCKKQKADVRGIGRAVEIPISHKDQQLPANLPPMNKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG*
Ga0137426_127325223300011435SoilVRGLGRGMEIPISYKDQQLPANLPPMNKVMHWDLEIGNWSHYTSGSDMELMVAGKMTVDEFKGPLRGGG*
Ga0137451_105922623300011438SoilMTFAEVLDWCKKQKANVRGLGRGMEIPISYKDQQLPAELPPMSKVMHWDLAIGDWSHYTSGSDMDLMVAGKMTVDEFKSTLRGAG*
Ga0137452_132142223300011441SoilMTFAEVLEWCKKQKASVRGLGRGMEIPISYKDQQLPANLPPMSKVMHWDLEIGGWSHYTSGSDMELMVAGKMTVDEFKGTLRGGDDA*
Ga0137437_133328923300011442SoilMTFAEVLDWCKKQKADVRGLGRGMEVPISHKDQQLPANLPPMNAVMHWDLEIGDWSHYTSGSDMELMVGGKMTVDEFKGTRRGGG*
Ga0137445_107761523300012035SoilMTFAEVIDWCKKHQADVRGIGRGMEIPISHKDKQLPANLPTMSAIMHWDLEIGDWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
Ga0137430_124085113300012041SoilQSGQIREQTSGAAIMTFAEVLDWCKKQKANVRGLGRGMEIPISYKDQQLPAELPPMSKVMHWDLAIGNWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
Ga0137346_102732423300012137SoilMTFAEILDWCKKQKANVRGLGRGMEIPISYKDQQPPANLPPMSKVMHWDLEIGGWSHYTSGSDMELMVAGKMTVDEFK
Ga0137354_103263823300012143SoilMTFAEILDWCKKQKANVRGLGRGMEIPISYKDQQLPAELPPMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG*
Ga0137349_101313623300012160SoilMTFAEVLDWCKKQKADVRGLGRGMEIPISYKDQQLPAELPPMSKVMHWDLEICNWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
Ga0137447_110541613300012226SoilMTFAEVLDWCKKHQANVRGLGRGMEIPISYKDQDLPANLPPMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG*
Ga0164301_1162252323300012960SoilMTFADVLDWCKKHHADVRAIGRGMEIPISHNDHQLPANLPAMSAIMHWDPAIGDWSHYTSGSDMQLMVAGKLTLDGFKSTLRGAE*
Ga0075349_117261113300014305Natural And Restored WetlandsMTFAEVFDWCKKHKADVRAIGRAMEIPISHKDRHLPGDLPPMSKVMHWDLAIGDWSHYTSGSDMALMVAGKMTVDEFKGTLRGGG*
Ga0075350_100889023300014315Natural And Restored WetlandsMTFAEVFDWCKKHKADVRAIGRAMEIPISHKDRHHPGDLPPMSKVMHWDLAIGDWSHYTSGSDMALMVAGKMTVDEFKGTLRGGG*
Ga0180061_101412023300014861SoilMTFAEVLDWCQKQKADVRAIGRAMEIPISYKDKQLPANLPSISKVMHWDLEIGNWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
Ga0180068_103877323300014864SoilMTFAEVLDWCKKQKANVRGLGRGMEIPISYKDQQLPADLPPMSKVMHWDLEIGNWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
Ga0180080_105118323300014870SoilMTFAEVLDWCKKQKANVRGLGRGMEIPISYKDQQLPANLPPMSKVMHWDLEIGGWSHYTSGSDMELMVAGKMTV
Ga0180075_102221923300015252SoilMTFAEVLDWCKKQKASVRGLGRGMEIPISYKDQQLPADLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG*
Ga0187775_1026522013300017939Tropical PeatlandMTFAEVLEWCKKHHADVRGISRGRDIAISHHDNALPAQLPSVDEIFHWDVEVGDWSHYTSGSDMERMVTGKMTIDEFKSTLRRGE
Ga0187787_1005589523300018029Tropical PeatlandMTFAEVLEWCKKHHADVRGISRGRDIAISHHDNALPAQLPSVDEIIHWDVEVGDWSHYTSGSDMERMVTGKMTIDEFKSTLRRGE
Ga0184628_1000149463300018083Groundwater SedimentMTFAEILDWCKKQKANVRGLGRGMEIPISYKDQQLPAELPPMSKVMHWDLEIGNWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG
Ga0184629_1029190423300018084Groundwater SedimentMTFAEVLDWCKKQKANVRGLGRGMEIPISYKDQQLPADLPPMSKVMHWDLEIGNWSHYTSGSDMELMVAGKMTVDDFKGTLRGGG
Ga0184629_1049426223300018084Groundwater SedimentMTFAEVIDWCKKHQADVRGIGRGMEIPISHKDKQLPANLPTMSAIMHWDLEIGDWSHYTSGSDMELMVAGKMTVDEFKSTLRGAG
Ga0190265_1012561823300018422SoilMTFAEILDWCKKQKANVRGLGRGMEIPISYKDQQLPADLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG
Ga0190272_1029919813300018429SoilMTFAEILDWCKKQKANVRGLGRGMEIPISYKDQQLPADLPPMSKVMHWDLEIGNWSHYTSGSDMELMVAGKMTVDEFKSTLRGGG
Ga0190272_1164840513300018429SoilMTFAEILDWCKKQKANVRGLGRGMEIPISYNDQQLPAELPPMSKVMHWDLEIGNWSHYTSGSDMELMVAGKMTIDEFKSTLRGGG
Ga0190275_1063085723300018432SoilMTFAEILDWCKKQKSNVRGLGRGMEIPISYKDQQLPADLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG
Ga0190275_1104209413300018432SoilMTFAEILDWCKKQKANVRGLGRGMEIPISYNDQQLPAELPPMSKVMHWDLEIGNWSHYTSGSDMELMVAGKM
Ga0190268_1002602633300018466SoilMTFAEVLDWCKKQKANVRGLGRGMEIPISYKDQQLPADLPPMSKVMHWDLEIGNWSHYTSGSDMELMVAGKMTVDEFKSTLRGGG
Ga0190273_1039328113300018920SoilSGAAIMTFAEILDWCKKQKANVRGLGRGMEIPISYKDQQLPSDLPPMSKVMHWDLEIGNWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG
Ga0190273_1242990413300018920SoilMTFAEVLDWCKKQKANVRALGRGMEIPISYNDQQLPANLPPMSKVMHWDLEIGDWSHYTSGSDMELMVA
Ga0180119_117147213300019228Groundwater SedimentMTFAEVFDWCKKQKADVRGIGRAVEIPISHKDQQLPANLPPMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG
Ga0180116_130399023300019229Groundwater SedimentMTFAEILDWCKKQKANVRGLGRGMEIPISHKDQQLPANLPPMSKVMHWDLEIGNWSHYTSGSDMELMVAGKMTVDEFKG
Ga0180117_139033813300019248Groundwater SedimentMTFAEVLEWCKKQKASVRGLGRGMEITISYKDQQLPANLPPMSKVMHWDLEIGDWSHYTSGSDMELMVDGKMTVDQFKGTLRGGG
Ga0180115_126771213300019257Groundwater SedimentMTFAEVLDWCQKQKADVRAIGRAMEIPISYKDKQLPANLPSISKVMHWDLAIGEWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG
Ga0173481_1071746513300019356SoilMTFAEVLDWCKKQKANVRALGRGMEIPISYKDQQLPANLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG
Ga0180107_100350013300020064Groundwater SedimentMTFAEVLEWCKKQKASVRGLGRGMEIPISYKDQQLPANLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG
Ga0163153_1004259223300020186Freshwater Microbial MatMTFAEVFDWCKKQKADVRGIGRGLEIPISHKDPQLPANLPSMGLIMHWDLEIGDWGHYTSGSDMELMVAGKLTVDQFKGTLRGGG
Ga0163150_1008470533300020195Freshwater Microbial MatCKKQKADVRGIGRGLEIPISHKDPQLPANLPSMGLIMHWDLEIGDWGHYTSGSDMELMVAGKLTVDQFKGTLRGGG
Ga0224505_1008986823300022214SedimentMTFAEVFEWCKKQKADARAIGRGMAIPISHKDKQLPANLPPMGKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG
Ga0224510_1013571013300022309SedimentKKQKADARAIGRGMAIPISHKDKQLPANLPPMGKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG
Ga0209172_10003097113300025310Hot Spring SedimentMTFAEVLDWCKKQKADVRGIGRHMEVSISHKDQQLPANLPPMSKVLHWNLEIGDWSHYTSGSDMERMVAGKMTLDEFKSTLRRAE
Ga0210099_103534123300025562Natural And Restored WetlandsMTFAEVLEWCKKQKADVRGIGRNMEIPISHKDNRLPANLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG
Ga0210066_105678613300025951Natural And Restored WetlandsMTFAEVFDWCKKHKADVRAIGRAMEIPISHHDRHLPGDLPPISKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG
Ga0209131_111096333300026320Grasslands SoilMTFAEVLDWCKKHHADVRGIGRGMEIPISYKDQHLPANLPSMNAIMHWDLAIGDWSHYTSGSDMELMVAGKLTVDGFKSTLRGSE
Ga0256805_104042623300026485SedimentMTFAEVFEWCKKHKADVRAIGRAMEIPISHNDKQIPANLPPMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMSVEEFKGTLRGGG
Ga0209464_1021627923300027778Wetland SedimentMTFAEVLEWCKKQKADVRAIGRALEVPISHKDKQLPANLPPISKVMHWDLEIGDWSHYTSGSDMELMV
Ga0209726_1005847023300027815GroundwaterMTFADVLAWCKKEKADVRAIGRAMEIPISHKDQELPANLPPMTKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDEFKSTLRGPG
Ga0209726_1023885023300027815GroundwaterMTFAEVLDWCKKQQADVRAIGRNLEMPISHKDNQLPANLPPISKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG
Ga0209726_1040221123300027815GroundwaterMTFADVLDWCKKHHAEVRGIGRGKEIPISHKDKELPANLPLMSAIMHWNLAIGDWSHYTSGSDMELMVAGKMTVDEFKSTLRGPG
Ga0209706_1048907223300027818Freshwater SedimentMTFAEVFDWCKKQKADVRGIGRGLEIPISHKDPQLPANLPSTGLIMHWDLEIGDWSHYTSGSDMELMVAGKMTVDDFKGTLRGGG
Ga0209683_1000699633300027840Wetland SedimentMTFAEVLEWCKKQKADVRAIGRALEVPISHKDKQLPANLPPISKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKSTLRGGG
Ga0209683_1010175123300027840Wetland SedimentMTFAEVLDWCKKHKADVRALGRGMEIPISHKDNQLPANLPPMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG
Ga0209798_1002180843300027843Wetland SedimentMTFAEVFDWCKKQKADVRAIGRGMEIPISHKDQQLSANLPPMSQIMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG
Ga0209705_1018682823300027979Freshwater SedimentMTFAEVFDWCKKHKADVRAIGRAMEIPISHKDKQLPANLPSMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMTVDEFKGTLRGRG
Ga0247663_101246223300028145SoilMTFADVLDWCKKHHADVRAIGRGMEIPISHNDHQLPANLPAMSAIMHWDLAIGDWSHYTSGSDMQLMVAGKLTLDGFKSTLRGAE
Ga0310888_1049613013300031538SoilMTFAEVLDWCKKQKANVRALGRGMEIPISYKDQQLPANLPPISKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG
Ga0307408_10010784333300031548RhizosphereMTFAEVLDWCKKQKANVRALGRGLEIPISYNDQQLPANLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG
Ga0310892_1123288823300031858SoilMTFAEVLDWCKKQKANVRGLGRGMEIPISHKDQQLPANLPPMSKVMHWDLEIGSWSHYTSGSDMELMVAGKMTVDEFKGTLRGGG
Ga0326597_10006600123300031965SoilMTFAEVLDWCKEQKADVRGIGRGMEIPISHKDRQLPANLPPMSKVMHWDLEIGDWSHYTSGSDMERMVTGKMTLNEFKSTLRRGAA
Ga0315910_1159434523300032144SoilMTFAEVLDWCKKQKANVRALGRGMEILISYKDQQLPGNLPPMSKVMHWDLEIDDWSHYTSGSDMELMVAGKMTVDQFKGTLRGGG
Ga0315270_1035859223300032275SedimentMTFAEVLDWCKKHQADVRGIGRGKEIPISHKDEQLPTNLPPMSAIMHWDLAIGDWSHYTSGSDMDLMVAGKMTVDEFKSTLRGSG
Ga0316604_1067463813300033406SoilSVRGLGRGMEITISYKDQQLPANLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMSVDEFKGTLRGGG
Ga0316605_1048911023300033408SoilMTFAEVFDWCKKHKADVRAIGRAMEIPISHKDKQLPGNLPPMSKVMHWDLAIGDWSHYTSGSDMELMVAGKMSVDEFKGTLRGGG
Ga0316601_10037288423300033419SoilMTFAEVLEWCKKQKASVRGLGRGMEITISYKDQQLPANLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMSVDEFKGTLRGGG
Ga0364933_090078_548_7723300034150SedimentMTFAEILDWCKKQKANVRGLGRGMEIPISYKDQQLPAELPPMSKVMHWDLEIGNWSHYTSGSDMELMVAGKMTVD
Ga0314780_085219_2_2533300034659SoilMTFAEVLDWCKKQKANVRALGRGMEIPISYKDQQLPANLPPMSKVMHWDLEIGDWSHYTSGSDMELMVAGKMTVDQFKGTLRGG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.