NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold YBBDRAFT_1056150

Scaffold YBBDRAFT_1056150


Overview

Basic Information
Taxon OID3300001372 Open in IMG/M
Scaffold IDYBBDRAFT_1056150 Open in IMG/M
Source Dataset NameYB-Back-sed
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of South Carolina
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1113
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location NameYoungs Bay mouth
CoordinatesLat. (o)46.15968Long. (o)-123.80651Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092939Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
YBBDRAFT_10561503F092939N/AYPPDDAVKNLIRMSAYMDKKLGAINANQFIDLSILDELGTKRNERSPQR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.