Scaffold JGI20225J14565_1035626

Overview

Basic Information

• Taxon OID: 3300001368
• Scaffold ID: JGI20225J14565_1035626
• Source Dataset Name: Microbial communities from bioreactor (seeded with sewage sludge) at LBNL, California, USA - Biofuel metagenome 4
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1313
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales → Methanoregulaceae → Methanoregula (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Bioreactor → Microbial Communities From Bioreactor (Seeded With Sewage Sludge) At Lbnl, California, Usa

Source Dataset Sampling Location

• Location Name: Lawrence Berkeley National Laboratory, California, USA
• Coordinates
  • Lat. (^o): 37.8754404
  • Long. (^o): -122.2477251

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089576	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20225J14565_10356262	F089576	AGG	MFGLPDITIIVFGGVTLVAIVALLYWGLTFRGHD*