NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI20131J14367_1032585

Scaffold JGI20131J14367_1032585


Overview

Basic Information
Taxon OID3300001337 Open in IMG/M
Scaffold IDJGI20131J14367_1032585 Open in IMG/M
Source Dataset NameHot spring microbial streamer communities from Conch Spring, Yellowstone National Park, USA - CON_C
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)505
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameConch Spring, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.376Long. (o)-110.69Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021443Metagenome / Metatranscriptome219Y

Sequences

Protein IDFamilyRBSSequence
JGI20131J14367_10325851F021443N/AYGYYQTNGIFSFAVMDLVFRIIKQQKRKSIILKKRKPIIHLLNYVDILNSNFISNKFDITFSLKNNYKTQLIYNLHSYRNSYRRRYYKDFYKDGLAVIERENLCIIRLEHNYASEIQPKNSNLVTMLIHILDKEGIDMIVGDGIIFYCVFLM*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.