Scaffold JGI20131J14367_1001283

Overview

Basic Information

• Taxon OID: 3300001337
• Scaffold ID: JGI20131J14367_1001283
• Source Dataset Name: Hot spring microbial streamer communities from Conch Spring, Yellowstone National Park, USA - CON_C
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3363
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → Pyrobaculum ferrireducens (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location

• Location Name: Conch Spring, Yellowstone National Park, Wyoming, USA
• Coordinates
  • Lat. (^o): 44.376
  • Long. (^o): -110.69

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075483	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20131J14367_10012832	F075483	AGAAG	MIELLLVQAVTTAALAFFVIKLRRELWPMFAMAKSGEVGFWVRTVDVLAVETPQLDASKVVIKVRWLFSEEIHMKYRLRIYDVAMHPYRRHHYVRWRAWMQGDNRYKCEVEKPRGLSRIYTKAIDVFCREVKKDEKKEVVILPSRWRKRRYRHWTKPEPSRGAPS*