Scaffold Microbial15j_103070

Overview

Basic Information

• Taxon OID: 3300001321
• Scaffold ID: Microbial15j_103070
• Source Dataset Name: Bioengineered switchgrass rhizosphere microbial community from Knoxville, Tennessee, USA - 15 Joint
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 606
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Bioengineered Switchgrass Rhizosphere Microbial Community From Knoxville, Tennessee, Usa

Source Dataset Sampling Location

• Location Name: Knoxville, Tennessee, USA
• Coordinates
  • Lat. (^o): 35.98
  • Long. (^o): -83.92

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013354	Metagenome	272	Y

Sequences

Protein ID	Family	RBS	Sequence
Microbial15j_1030701	F013354	N/A	FRELAKKAEGARLDEIRQTVARLQTDNEKIDLLIQIAGDTQKTNEKLAVQVLDEARQIVNHRATNYQQFEQQLKVAHAFADVDAARAFEVLEPGIGQLNELLQAASTLSGFEINMFRDGEMAIQGGNGLTATVNRYGQELAVLAKNDFERAETLTGRFQFTEPRIMTRLAIVQGLLNAKPVSGGTRIITGGFSETVVTRP*