NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BBAY84_10132892

Scaffold BBAY84_10132892


Overview

Basic Information
Taxon OID3300001265 Open in IMG/M
Scaffold IDBBAY84_10132892 Open in IMG/M
Source Dataset NameMacroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY84
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)661
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Source Dataset Sampling Location
Location NameAustralia: Botany Bay, Sydney, NSW
CoordinatesLat. (o)-33.966629Long. (o)151.166614Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012678Metagenome / Metatranscriptome278Y

Sequences

Protein IDFamilyRBSSequence
BBAY84_101328922F012678N/AMLNQHSLEEIADIHNLLEDIKKEYNYGIKPILINHSPSRFKNPHTVPKLKKIQINRGLGLAAQSTNILKKNIP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.