Scaffold SwM_12973

Overview

Basic Information

• Taxon OID: 3300001221
• Scaffold ID: SwM_12973
• Source Dataset Name: Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Tennessee
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 515
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa

Source Dataset Sampling Location

• Location Name: East Tennessee Research and Education Center, Knoxville, Tennessee, USA
• Coordinates
  • Lat. (^o): 35.9606
  • Long. (^o): -83.9208

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000788	Metagenome / Metatranscriptome	891	Y

Sequences

Protein ID	Family	RBS	Sequence
SwM_129731	F000788	GGA	MKPRTVYEKAVQDFTEIAQQLARLNQHFRQASFSEFEMLMGLDDEVLKRYGLPKPTVKRALIEVYQTVVLDQAR*