NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGIcombinedJ13530_100497500

Scaffold JGIcombinedJ13530_100497500


Overview

Basic Information
Taxon OID3300001213 Open in IMG/M
Scaffold IDJGIcombinedJ13530_100497500 Open in IMG/M
Source Dataset NameCombined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)778
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland → Wetland Microbial Communities From Twitchell Island In The Sacramento Delta

Source Dataset Sampling Location
Location NameTwitchell Island in the Sacramento/San Joaquin Delta, CA
CoordinatesLat. (o)38.107057Long. (o)-121.647578Alt. (m)Depth (m)0 to .12
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F091197Metagenome107Y

Sequences

Protein IDFamilyRBSSequence
JGIcombinedJ13530_1004975002F091197GGALNPAPRPEKLAPMYEFLGKLFFRRLPPDLQRRKINILLAVLVVGLLLGGLIAILLVLSNRIGMR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.