NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F091197

Metagenome Family F091197

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F091197
Family Type Metagenome
Number of Sequences 107
Average Sequence Length 53 residues
Representative Sequence MYEFFGKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLLVLMMVLRNKIGVR
Number of Associated Samples 85
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 54.21 %
% of genes near scaffold ends (potentially truncated) 20.56 %
% of genes from short scaffolds (< 2000 bps) 63.55 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.720 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(25.234 % of family members)
Environment Ontology (ENVO) Unclassified
(74.766 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(54.206 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 55.00%    β-sheet: 0.00%    Coil/Unstructured: 45.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF12857TOBE_3 50.47
PF00528BPD_transp_1 8.41
PF00850Hist_deacetyl 5.61
PF00583Acetyltransf_1 4.67
PF07396Porin_O_P 2.80
PF00291PALP 1.87
PF07963N_methyl 0.93
PF03928HbpS-like 0.93
PF01507PAPS_reduct 0.93
PF13531SBP_bac_11 0.93
PF08241Methyltransf_11 0.93
PF00069Pkinase 0.93
PF02082Rrf2 0.93
PF00437T2SSE 0.93
PF00348polyprenyl_synt 0.93
PF06071YchF-GTPase_C 0.93
PF17189Glyco_hydro_30C 0.93
PF10055DUF2292 0.93
PF16355DUF4982 0.93
PF00149Metallophos 0.93
PF13561adh_short_C2 0.93
PF00873ACR_tran 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 11.21
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.74
COG3746Phosphate-selective porinInorganic ion transport and metabolism [P] 2.80
COG0012Ribosome-binding ATPase YchF, GTP1/OBG familyTranslation, ribosomal structure and biogenesis [J] 0.93
COG0142Geranylgeranyl pyrophosphate synthaseCoenzyme transport and metabolism [H] 0.93
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 0.93
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 0.93
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 0.93
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 0.93
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.93
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.93
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 0.93
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.72 %
UnclassifiedrootN/A10.28 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000567|JGI12270J11330_10084852All Organisms → cellular organisms → Bacteria1470Open in IMG/M
3300001213|JGIcombinedJ13530_100497500Not Available778Open in IMG/M
3300009518|Ga0116128_1075011All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300009518|Ga0116128_1105309All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300009518|Ga0116128_1119121All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium768Open in IMG/M
3300009519|Ga0116108_1000548All Organisms → cellular organisms → Bacteria21271Open in IMG/M
3300009547|Ga0116136_1040284All Organisms → cellular organisms → Bacteria1365Open in IMG/M
3300009547|Ga0116136_1101109All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium750Open in IMG/M
3300009548|Ga0116107_1008581All Organisms → cellular organisms → Bacteria4481Open in IMG/M
3300009614|Ga0116104_1000010All Organisms → cellular organisms → Bacteria257634Open in IMG/M
3300009616|Ga0116111_1018117All Organisms → cellular organisms → Bacteria2546Open in IMG/M
3300009616|Ga0116111_1133922All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium599Open in IMG/M
3300009617|Ga0116123_1122143All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium683Open in IMG/M
3300009618|Ga0116127_1003936All Organisms → cellular organisms → Bacteria → Proteobacteria6597Open in IMG/M
3300009621|Ga0116116_1110115All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium747Open in IMG/M
3300009630|Ga0116114_1115405All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium704Open in IMG/M
3300009639|Ga0116122_1042874All Organisms → cellular organisms → Bacteria1546Open in IMG/M
3300009641|Ga0116120_1128856All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium822Open in IMG/M
3300009645|Ga0116106_1282609Not Available528Open in IMG/M
3300009762|Ga0116130_1074171All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium1068Open in IMG/M
3300010341|Ga0074045_10002580All Organisms → cellular organisms → Bacteria16745Open in IMG/M
3300010343|Ga0074044_10003035All Organisms → cellular organisms → Bacteria14447Open in IMG/M
3300010343|Ga0074044_10160820All Organisms → cellular organisms → Bacteria1501Open in IMG/M
3300010379|Ga0136449_100098280All Organisms → cellular organisms → Bacteria6030Open in IMG/M
3300014156|Ga0181518_10006429All Organisms → cellular organisms → Bacteria9869Open in IMG/M
3300014158|Ga0181521_10092763All Organisms → cellular organisms → Bacteria1879Open in IMG/M
3300014158|Ga0181521_10305575Not Available814Open in IMG/M
3300014161|Ga0181529_10423636Not Available716Open in IMG/M
3300014162|Ga0181538_10033798All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3347Open in IMG/M
3300014165|Ga0181523_10287972All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium930Open in IMG/M
3300014490|Ga0182010_10088282All Organisms → cellular organisms → Bacteria1537Open in IMG/M
3300014490|Ga0182010_10147315All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300014494|Ga0182017_10329769All Organisms → cellular organisms → Bacteria952Open in IMG/M
3300014502|Ga0182021_10561091All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1365Open in IMG/M
3300014657|Ga0181522_10016157All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4030Open in IMG/M
3300014839|Ga0182027_10184699All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2430Open in IMG/M
3300014839|Ga0182027_10992397All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium861Open in IMG/M
3300017925|Ga0187856_1008178All Organisms → cellular organisms → Bacteria6326Open in IMG/M
3300017925|Ga0187856_1025643All Organisms → cellular organisms → Bacteria2900Open in IMG/M
3300017925|Ga0187856_1106833All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300017929|Ga0187849_1098357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis1246Open in IMG/M
3300017935|Ga0187848_10020293All Organisms → cellular organisms → Bacteria3509Open in IMG/M
3300017938|Ga0187854_10025154All Organisms → cellular organisms → Bacteria3240Open in IMG/M
3300017940|Ga0187853_10001002All Organisms → cellular organisms → Bacteria27090Open in IMG/M
3300017940|Ga0187853_10181986All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300017948|Ga0187847_10245925All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium974Open in IMG/M
3300017961|Ga0187778_10559096All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300017975|Ga0187782_11686649All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium501Open in IMG/M
3300017988|Ga0181520_10875264All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium601Open in IMG/M
3300017996|Ga0187891_1227535All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium627Open in IMG/M
3300017998|Ga0187870_1318561All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium519Open in IMG/M
3300018002|Ga0187868_1019843All Organisms → cellular organisms → Bacteria3259Open in IMG/M
3300018009|Ga0187884_10013043All Organisms → cellular organisms → Bacteria4782Open in IMG/M
3300018013|Ga0187873_1322266Not Available566Open in IMG/M
3300018019|Ga0187874_10060504All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Xanthomonas → Xanthomonas oryzae → Xanthomonas oryzae pv. oryzae → Xanthomonas oryzae pv. oryzae KACC 103311728Open in IMG/M
3300018019|Ga0187874_10175122All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300018019|Ga0187874_10283944All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300018020|Ga0187861_10289744All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium704Open in IMG/M
3300018021|Ga0187882_1092941All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300018023|Ga0187889_10087677All Organisms → cellular organisms → Bacteria → Proteobacteria1562Open in IMG/M
3300018026|Ga0187857_10464203All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium568Open in IMG/M
3300018037|Ga0187883_10011744All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4951Open in IMG/M
3300018040|Ga0187862_10379582All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia872Open in IMG/M
3300018040|Ga0187862_10680759Not Available603Open in IMG/M
3300018043|Ga0187887_10333618All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300018046|Ga0187851_10602280All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium621Open in IMG/M
3300018057|Ga0187858_10161185All Organisms → cellular organisms → Bacteria1488Open in IMG/M
3300018085|Ga0187772_10100685All Organisms → cellular organisms → Bacteria1861Open in IMG/M
3300018090|Ga0187770_11000988All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium672Open in IMG/M
3300018090|Ga0187770_11733207All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium511Open in IMG/M
3300022524|Ga0224534_1000454All Organisms → cellular organisms → Bacteria26255Open in IMG/M
3300025444|Ga0208189_1100182All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300025446|Ga0208038_1011958All Organisms → cellular organisms → Bacteria2459Open in IMG/M
3300025469|Ga0208687_1014705All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia2317Open in IMG/M
3300025496|Ga0208191_1074114Not Available713Open in IMG/M
3300025501|Ga0208563_1057233Not Available819Open in IMG/M
3300025533|Ga0208584_1003499All Organisms → cellular organisms → Bacteria → Proteobacteria3892Open in IMG/M
3300025548|Ga0208716_1012570All Organisms → cellular organisms → Bacteria2197Open in IMG/M
3300025739|Ga0209745_1030313All Organisms → cellular organisms → Bacteria2177Open in IMG/M
3300025764|Ga0209539_1305694All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium542Open in IMG/M
3300026474|Ga0247846_1096629Not Available518Open in IMG/M
3300027854|Ga0209517_10005852All Organisms → cellular organisms → Bacteria15450Open in IMG/M
3300027905|Ga0209415_10153632All Organisms → cellular organisms → Bacteria2305Open in IMG/M
3300028653|Ga0265323_10058045All Organisms → cellular organisms → Bacteria1352Open in IMG/M
3300028666|Ga0265336_10187994All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia614Open in IMG/M
3300028800|Ga0265338_10001094All Organisms → cellular organisms → Bacteria45068Open in IMG/M
3300028800|Ga0265338_10172116All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1659Open in IMG/M
3300031726|Ga0302321_103330832Not Available523Open in IMG/M
3300031902|Ga0302322_102894499All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium591Open in IMG/M
3300032770|Ga0335085_10213130All Organisms → cellular organisms → Bacteria2354Open in IMG/M
3300032782|Ga0335082_10385143All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300032783|Ga0335079_10016972All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → Pedosphaera → Pedosphaera parvula8316Open in IMG/M
3300032783|Ga0335079_10051790All Organisms → cellular organisms → Bacteria4699Open in IMG/M
3300032783|Ga0335079_10165871All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium2470Open in IMG/M
3300032805|Ga0335078_10009191All Organisms → cellular organisms → Bacteria14655Open in IMG/M
3300032805|Ga0335078_10347908All Organisms → cellular organisms → Bacteria1970Open in IMG/M
3300032805|Ga0335078_11140051All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300032828|Ga0335080_10001895All Organisms → cellular organisms → Bacteria20759Open in IMG/M
3300032892|Ga0335081_10072115All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium5274Open in IMG/M
3300032892|Ga0335081_11392700All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium784Open in IMG/M
3300032893|Ga0335069_12752872All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium505Open in IMG/M
3300032897|Ga0335071_11500466All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium618Open in IMG/M
3300032955|Ga0335076_10037713All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales4836Open in IMG/M
3300033402|Ga0326728_10004142All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia43587Open in IMG/M
3300033402|Ga0326728_10508618Not Available976Open in IMG/M
3300033755|Ga0371489_0000016All Organisms → cellular organisms → Bacteria357733Open in IMG/M
3300033977|Ga0314861_0140263All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1191Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland25.23%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland21.50%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil13.08%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog7.48%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen5.61%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.67%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.74%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil3.74%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere3.74%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.80%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil2.80%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.87%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.87%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.93%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000567Peat soil microbial communities from Weissenstadt, Germany - SII-2010EnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009548Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100EnvironmentalOpen in IMG/M
3300009614Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150EnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009618Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100EnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014490Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300022524Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24EnvironmentalOpen in IMG/M
3300025444Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025446Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025469Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025501Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025533Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025548Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025739Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-312 (SPAdes)EnvironmentalOpen in IMG/M
3300025764Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0011-312 (SPAdes)EnvironmentalOpen in IMG/M
3300026474Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T0EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028653Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaGHost-AssociatedOpen in IMG/M
3300028666Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaGHost-AssociatedOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12270J11330_1008485223300000567Peatlands SoilMKRRLGKLLFPHLPSDLQQRKVNIILAVLFVGLLLGGIFAWAAIVGNRVSFR*
JGIcombinedJ13530_10049750023300001213WetlandLNPAPRPEKLAPMYEFLGKLFFRRLPPDLQRRKINILLAVLVVGLLLGGLIAILLVLSNRIGMR*
Ga0116128_107501113300009518PeatlandLNPAANPERLVSTDELFWKLLFPLLPPDLQRRKISTLLAVLWVGLLLGGLIALMMVLQA*
Ga0116128_110530913300009518PeatlandMKRLLGKLLFPSLPPDLQRRKVNIALAVVLVGLLLGSLLALMAILGNRVGPR*
Ga0116128_111912113300009518PeatlandMYEFFGKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLLVLMMVLRNKIGVR*
Ga0116108_1000548113300009519PeatlandLNPAANPERLVSTDELFWKLLFPRLPPDLQRRKISTLLAVLWVGLLLGGLIALMMVLQA*
Ga0116136_104028413300009547PeatlandMHEFLEKLLFPRLLPDLQRRKINILLAVLLVGLFLGGLIVLMMVLRNKIGVH*
Ga0116136_110110923300009547PeatlandLNLAANLERLMPMYEFFGKLLFPRLPPDLQRRKINIFLAVLLVGLLMGGLIVLMMVLRNKIGVR*
Ga0116107_100858153300009548PeatlandMYEFLGKLLFPRLPPDLQRRKINILLAVLLVGLLLGGFMALMLVYRNKMGVR*
Ga0116104_10000101633300009614PeatlandMYKFLGKLLFPRLPHDLQRRKVNILLAVLLIGLLLGGLIALMMVLRNKIGVR*
Ga0116111_101811743300009616PeatlandMCEFFWKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLIALVMILRNKIGVR*
Ga0116111_113392223300009616PeatlandLNPAANPERLVPMYEFFGKLLFPRLPPDLQRRKINILLAVLLVGLFLGGLTALMMVLRNKIGVR*
Ga0116123_112214313300009617PeatlandLNPAANPERLVSTDELFWKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLLVLMMVLRNKIGVR*
Ga0116127_100393643300009618PeatlandMYEFFGKLLFPRLPPDLQRRKINILLAVLLVGLFLGGLTALMMVLRNKIGVR*
Ga0116116_111011523300009621PeatlandLNPAANSEKLVPMYKFFGKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLIAFLIVLSNKVGVR*
Ga0116114_111540533300009630PeatlandMAPMNRFLGKLLFPRQPRDVQRRKINIILMVLLVSVLFGGLIALMLVLKNKASSP*
Ga0116122_104287433300009639PeatlandEFFGKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLLVLMMVLRNKIGVR*
Ga0116120_112885623300009641PeatlandLNSAANPERLVPMYKFLGKLLFPRLPHDLQRRKVNILLAVLLIGLLLGGLIALMMVLRNKIGVR*
Ga0116106_128260913300009645PeatlandKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLLVLMMVLRNKIGVR*
Ga0116130_107417123300009762PeatlandMNRFLGKLLFPRLPPDLQRRKINTILAVLLVGLLLGGLVALVALVSNRVGDR*
Ga0074045_1000258063300010341Bog Forest SoilMHRLFGKLLFPRLPPDLQRRKINTLLTVLLVGLLLGGLIALVMVLSNKIGVR*
Ga0074044_10003035143300010343Bog Forest SoilMNRFLGRLLFPRLPSDLQRRKVNIILAVLLVSLLLGALLALVAVVSNKVGTR*
Ga0074044_1016082023300010343Bog Forest SoilMNRLLGKLLFPSLPPDLQRRKINIILAVLLVGLLLGSLVALVAVVSNKVGPR*
Ga0136449_10009828053300010379Peatlands SoilMNRFLGRLLFPRLPSDLQRRKVNIILAVLLVSLLLGALLALVAVVSNKVGTH*
Ga0181518_1000642973300014156BogVVNRFLGKLLFPRLPSDLQRRKINIILAVLLVGLLLGGLVALVAVVSNKVGVR*
Ga0181521_1009276333300014158BogMYEFLGKLLFPRLPPDLQRRKITITLAVLLVGLLLGGLIALMIVLRNKIGVR*
Ga0181521_1030557523300014158BogMINYLGKLLFPRLPRDVQRRKINIILMVLLVSLLLGGFIAFMLVFRNKMGVP*
Ga0181529_1042363613300014161BogDVGVVNRFLGKLLFPRLPSDLQRRKINIILAVLLVGLLLGGLVALVAVVSNKVGVR*
Ga0181538_1003379873300014162BogDELFWKLLFPRLPPDLQRRKISTLLAVLWVGLLLGGLIALMMVLQA*
Ga0181523_1028797233300014165BogLNPAANPERLVPMYEFLGKLLFPRLPPDLQRRKITITLAVLLVGLLLGGLIALMIVLRNKIGVR*
Ga0182010_1008828213300014490FenVNRFLGRLLFPRLPSDLQRRKINIILMVLVVGLLLGGFVALMAVVTNRVG
Ga0182010_1014731523300014490FenMNRFLGKLLFPRQPRDVQRRKANIVLMVLLVGLFLGGLIALMLVYRNKMGVR*
Ga0182017_1032976923300014494FenVNRFLGRLLFPRLPSDLQRRKINIILMVLVVGLLLGGFVALMAVVTNRVGAR*
Ga0182021_1056109123300014502FenVNRFLGKLLFPHLPSDLRRRKVNIILGVLLAGLLLGGLVALMAVVGNKVGPR*
Ga0181522_1001615713300014657BogMIRFFGRLLFPRLPSDLQRRKINIILAVLLVGLLLGGLMALVAVVSNKVGPR*
Ga0182027_1018469953300014839FenLNPAANAERLVPMYEFWEKLLFPRLPPDLQRRKINIFLTVLLVGLLLSGLIALMMVLRNKIGIR*
Ga0182027_1099239723300014839FenMCEFFWKLLFPRLPPDLQRRKINTLLAVRLVGLLLGGLIALMTVLRNKTGVR*
Ga0187856_100817833300017925PeatlandLNPAANPERLVSTDELFWKLLFPRLPPDLQRRKISTLLAVLWVGLLLGGLIALMMVLQA
Ga0187856_102564333300017925PeatlandMHEFLEKLLFPRLLPDLQRRKINILLAVLLVGLFLGGLIVLMMVLRNKIGVH
Ga0187856_110683323300017925PeatlandMYEFFGKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLLVLMMVLRNKIGVR
Ga0187849_109835713300017929PeatlandMKRLLGKLLFPSLPPDLQRRKVNIALAVVLVGLLLGSLLALMAILGNRVGPR
Ga0187848_1002029343300017935PeatlandMNRFLGRLLFPRLPSDLQRRKVNIILAVLLVSLLLGALLALVAVVSNKVGTR
Ga0187854_1002515443300017938PeatlandMYKFLGKLLFPRLPHDLQRRKVNILLAVLLIGLLLGGLIALMMVLRNKIGVR
Ga0187853_10001002123300017940PeatlandLNPAANPERLVSTDELFWKLLFPRLPPDLQRRKISTLLADLWVGLLLGGLIALMMVLQA
Ga0187853_1018198623300017940PeatlandLNPAANSERLMPMYEFFGKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLLVLMMVLRNKIGVR
Ga0187847_1024592523300017948PeatlandMIRFFGRLLFPRLPSDLQRRKVNIILAVLLVGLLLGGLMALVAIVSNKVGPR
Ga0187778_1055909623300017961Tropical PeatlandMNRYLGKLFFPRLPSDLQRRKINTVLAVLLVGLLLGGLFALVAIVSNKVDVR
Ga0187782_1168664913300017975Tropical PeatlandMTRMLGRLLFPHLPSDLRRRKMNTIVAVLLVGLVLGGLLALMVVVSNRVDTH
Ga0181520_1087526423300017988BogMIRFFGRLLFPRLPSDLQRRKVNIILAVLLVGLLFGGLMALVAIVSNKVGPR
Ga0187891_122753523300017996PeatlandMYEFFGKLLFPRLPPDLQRRKINIFLAVLLVGLLMGGLIVLMMVLRNKIGVR
Ga0187870_131856123300017998PeatlandMYKFFGKLFFRRLPPDLQRRKINILLAVLLVGLLLSGLIALMIVLSNKIGAY
Ga0187868_101984353300018002PeatlandVRIFWKLLFPRLLPDLQRRKINTLLAVLLVGLLLGGLIVLMMVLRNKIGVR
Ga0187884_1001304363300018009PeatlandMCEFFWKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLIALVMILRNKIGVR
Ga0187873_132226633300018013PeatlandGKLLFPRLPPDLQRRKINILLAVLLVGLLLGGFMALMLVYRNKMGVR
Ga0187874_1006050423300018019PeatlandMYEFFGKLLFPRLPPDLQRRKINILLAVLLVGLFLGGLTALMMVLRNKIGVR
Ga0187874_1017512223300018019PeatlandMYEFLGKLLFPRLPPDLQRRKISTLLAVLWVGLLLGGLIALMMVLQA
Ga0187874_1028394423300018019PeatlandERLVPMHEFLEKLLFPRLLPDLQRRKINILLAVLLVGLFLGGLIVLMMVLRNKIGVR
Ga0187861_1028974423300018020PeatlandLNPAANSEKLVPMYKFFGKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLIAFLIVLSNKVGVR
Ga0187882_109294113300018021PeatlandVNRLLGKLLFPHLPHDLQRRKVNIILAVLLVSLLLGGLVALMAVLSNRVGVR
Ga0187889_1008767723300018023PeatlandMPMYEFFGKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLLVLMMVLRNKIGVR
Ga0187857_1046420313300018026PeatlandMKRLLGKLLFPSLPPDLQRRKVNIALAVVLVGLLLGSLLALMANLGNRVGP
Ga0187883_1001174483300018037PeatlandLNPAANPERLVSTDELFWKLLFPRLPPDLQRRKVSTLLAVLWVGLLLGGLIALMMVLQA
Ga0187862_1037958223300018040PeatlandMAPMNRFLGKLLFPRQPRDVQRRKINIILMVLLVSVLFGGLIALMLVLKNKASSP
Ga0187862_1068075913300018040PeatlandMNRFLGKLLFPRLPPDLQRRKINTILAVPSVGLLLSGLVALVAL
Ga0187887_1033361823300018043PeatlandMIRFFGRLLFPRLPSDLQRRKVNIILAVLLVGLLLGGLMALVAIVSN
Ga0187851_1060228023300018046PeatlandVIRFLGRLLFPRLPSDVQRRKVNIILMVLLVGLLLGGLVALMAVVNNKVGVH
Ga0187858_1016118513300018057PeatlandVTRFLGKLLFPRLPSDLQRRKMNIILTVLVVGLLLGGLLALVAIVSNKVGVR
Ga0187772_1010068523300018085Tropical PeatlandMHHRLGRLLFPHLPSDLQRRKMSIVLAVLLVSLLLGGLMVLVVIASNKVGAR
Ga0187770_1100098823300018090Tropical PeatlandMHPRLGRLLFPHLPSDLQKRKMNIVLAVLFVSLLLGGLMVLVAIASNKVGPR
Ga0187770_1173320723300018090Tropical PeatlandMKRLLEKLLFPRLPQDLQRRKVNTILAAILVGLLLGGVVALMAILSNRVGPR
Ga0224534_1000454263300022524SoilMCEFFWKLLFPRLPPDLQRRKINTLLAVRLVGLLLGGLIALMTVLRNKTGVR
Ga0208189_110018233300025444PeatlandNHESMAPMNRFLGKLLFPRQPRDVQRRKINIILMVLLVSVLFGGLIALMLVLKNKASSP
Ga0208038_101195823300025446PeatlandLNPAANPERLVPMYEFFGKLLFPRLPPDLQRRKINILLAVLLVGLFLGGLTALMMVLRNKIGVR
Ga0208687_101470563300025469PeatlandMYEFLGKLLFPRLPPDLQRRKINILLAVLLVGLLLGGFMALMLVYRNKMGVR
Ga0208191_107411413300025496PeatlandRLVPMHEFLEKLLFPRLLPDLQRRKINILLAVLLVGLFLGGLIVLMMVLRNKIGVH
Ga0208563_105723313300025501PeatlandFWKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLIALVMILRNKIGVR
Ga0208584_100349943300025533Arctic Peat SoilMCEFFWKLLFPRLLPDLQRRKINTLLAVRLVGPLLGGLIVLMMVLRNKIGVR
Ga0208716_101257023300025548Arctic Peat SoilMCEFFWKLLFPRLLPDLQRRKINTLLAVRLVGPLLGGLIALMMVLRNKIGVR
Ga0209745_103031333300025739Arctic Peat SoilMYEFFGKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLIVLTMVLGNKIGVR
Ga0209539_130569413300025764Arctic Peat SoilMYEFFGKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLIVLTMVL
Ga0247846_109662913300026474SoilNHERLVPMNRFLGKLLFPRQPRDVQRRKANIVLMVLLVGLFLGGLIALMLVYRNKMGVR
Ga0209517_1000585293300027854Peatlands SoilMKRRLGKLLFPHLPSDLQQRKVNIILAVLFVGLLLGGIFAWAAIVGNRVSFR
Ga0209415_1015363233300027905Peatlands SoilMNRFLGRLLFPRLPSDLQRRKVNIILAVLLVSLLLGALLALVAVVSNKVGTH
Ga0265323_1005804523300028653RhizosphereMNDFLGKLLFPRQPRDVQRRKVNIILAVLLISVLLGGTIALLMVLGNKAGVR
Ga0265336_1018799433300028666RhizosphereRLLFPRFPSDVQRRKVNTILAVVLVGVLLGGLVALMAVISNRVGTH
Ga0265338_1000109433300028800RhizosphereMSRFLGKLLFPRLPSDLQRRKVNIILSVLLVGLILGGIVALVAVFTNKVGPR
Ga0265338_1017211623300028800RhizosphereMTRFLGKLLFPHLPSDLQRRKINIILAVLVVGLILGGLVALVSIFTNKIGSR
Ga0302321_10333083213300031726FenCRKLCDVGLVNRFLGRLLFPRLPSDLQRRKINIILMVLVVGLLLGGFVALMAVVTNRVGA
Ga0302322_10289449923300031902FenLCDVGLVNRFLGRLLFPRLPSDLQRRKINIILMVLVVGLLLGGFVALMAVVTNRVGAR
Ga0335085_1021313033300032770SoilLGKLLFPYLPSDLRRRKVNIILAVLLVSLLLGGIFVWAAIIGNKVNFR
Ga0335082_1038514313300032782SoilVTRLLGKLLFPHLPHDLQRRKVNIILAVLLVSLLLGGLVALMAILSNRVGVR
Ga0335079_1001697213300032783SoilMYEFLGKLFFRRLPPDLQRRQINIMLAVLFIGLLLGGLIALMMILNNKIGV
Ga0335079_1005179013300032783SoilMKRRLEKLLFPNLPSDLQRRKINTILAVLLVGLLLGGLFALVAIVTNKVEVR
Ga0335079_1016587123300032783SoilMKRRLGKLLFPQLPSDLQTRKINTILAVLLVGLLLGGLFALVAFVTNRVEVR
Ga0335078_1000919133300032805SoilMKRRLEKLLFPNLPSDLQRRKINTILAVLLVGLLLGGLFALVAIVANKVEVR
Ga0335078_1034790833300032805SoilMHLRLGKLLFPHLPSDLQRRKMNTVLVVLLVSLLLGGLIVLVAIASNKVGPR
Ga0335078_1114005123300032805SoilMNRLLGKLLFPHLPHDLQRRKVNIILAVVLVSLLLGGLLALVAVVSNKVGPR
Ga0335080_1000189583300032828SoilMYEFLGKLFFRRLPPDLQRRQINIMLAVLFIGLLLGGLIALMMILNNKIGVR
Ga0335081_1007211543300032892SoilMTRLLGKLLFPHLPHDLQRRKVNIILAVLLVSLLLGGIFVWAAIVGNNVGVR
Ga0335081_1139270023300032892SoilLPEACDALFMMRRLGKMLFPQFPSDLQRRKVNILLGVLLFALLLGGLFTWAALVGNRIGP
Ga0335069_1275287213300032893SoilMNRFLGKLLFPRLPSDLQRRKINIILAVLLVGLILGGLVALVAVVSNKVGPR
Ga0335071_1150046613300032897SoilCRKLCDVGFMTRLLGKLLFPHLPHDLQRRKVNIILAVLLVSLFLGGIFVWAAIVGNRVGV
Ga0335076_1003771363300032955SoilMTRFLGRLLFPRLPDDLQQRKVNIILGVIVASLLVGGLIVLMAVLGNRVGSR
Ga0326728_10004142173300033402Peat SoilMYEFLGKLLFPRLPPDLQRRKLNILFAVVLLGLVLGGVMAVLIVFNNRISVR
Ga0326728_1050861813300033402Peat SoilFWKLLFPRLPPDLQRRKINTLLAVLLVGLLLGGLIALVMVLRNKIGVR
Ga0371489_0000016_342215_3424003300033755Peat SoilVANLENLVPMYEFLGKLLFPRLPPDLQRRKLNILFAVVLLGLVLGGVMAVLIVFNNRISV
Ga0314861_0140263_526_6843300033977PeatlandMKRLLGKLLFPRLPPDLRRRKVNIVLAAVLVGLLLGGLVGLMAILSNRVGPR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.