| Basic Information | |
|---|---|
| Taxon OID | 3300001199 Open in IMG/M |
| Scaffold ID | J055_10006372 Open in IMG/M |
| Source Dataset Name | Lotic microbial communities from nuclear landfill site in Hanford, Washington, USA - IFRC combined assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Pacific Northwest National Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 7316 |
| Total Scaffold Genes | 10 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Lotic → Lotic Microbial Communities From Nuclear Landfill Site In Hanford, Washington, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hanford, Washington, USA | |||||||
| Coordinates | Lat. (o) | 46.371184 | Long. (o) | -119.275414 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F090835 | Metagenome | 108 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| J055_100063726 | F090835 | AGGAGG | MSDQEVLRKALNEIEGYRYRWGWSFGITAALSQAAWMLLIFGSPAASDKQTILMAALAVAMTVFGGVFLLVLLIYRMTHKILQAIEVGARRHP* |
| ⦗Top⦘ |