Scaffold JGI12649J13570_1029710

Overview

Basic Information

• Taxon OID: 3300001175
• Scaffold ID: JGI12649J13570_1029710
• Source Dataset Name: Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 573
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Edaphobacter → Edaphobacter lichenicola (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location

• Location Name: Thunder Bay, Ontario, Canada
• Coordinates
  • Lat. (^o): 49.08
  • Long. (^o): -89.38

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077523	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12649J13570_10297101	F077523	N/A	NLIHRNGGGSSDPALGALQLFQNNVITQSRLFSYIDIYFGLAMLGVVALISIAITRTKPKLGEHHFLLW*