NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12686J13345_102731

Scaffold JGI12686J13345_102731


Overview

Basic Information
Taxon OID3300001157 Open in IMG/M
Scaffold IDJGI12686J13345_102731 Open in IMG/M
Source Dataset NameForest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_O2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)877
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameDavy Crockett National Forest, Groveton, Texas, USA
CoordinatesLat. (o)31.11Long. (o)-95.15Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001123Metagenome / Metatranscriptome770Y
F037169Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
JGI12686J13345_1027311F037169N/ALILLKIGEELGIPVDIQNERLDPVDANISKLPIEDVARQLSPHIKLYYRADLTRAEKRALRMVLAEPPKATQGP*
JGI12686J13345_1027312F001123GGAGGMQNEIINEENSVKNANGADELKKAFVEPAISVPVDVLEATTFFQVASSGATN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.