Scaffold JGI12097J13213_1003884

Overview

Basic Information

• Taxon OID: 3300001113
• Scaffold ID: JGI12097J13213_1003884
• Source Dataset Name: Marine microbial communities from the Deep Pacific Ocean - MP2252
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 852
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: West of El Salvador, Pacific Ocean
• Coordinates
  • Lat. (^o): 10.09
  • Long. (^o): -99.25
  • Depth (m): 3007.91

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032684	Metagenome / Metatranscriptome	179	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12097J13213_10038842	F032684	N/A	MRLLCTLRVLALIDKFKSNFSLFRAEEVIFLPFGIITKNTLKNIIQPKITPTDKNANLDPKIFVKQNEITAPIMSSTTIKIIFLFINLDLQIRS*