3300001113: Marine microbial communities from the Deep Pacific Ocean - MP2252

Overview

Basic Information

• IMG/M Taxon OID: 3300001113
• GOLD Reference (Study | Sequencing Project | Analysis Project): Gs0053074 | Gp0054440 | Ga0000761
• Sample Name: Marine microbial communities from the Deep Pacific Ocean - MP2252
• Sequencing Status: Permanent Draft
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Published?: N
• Use Policy: Open

Dataset Contents

• Total Genome Size: 34500678
• Sequencing Scaffolds: 1
• Novel Protein Genes: 1
• Associated Families: 1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)

• Name: Deep Ocean Microbial Communities From The Global Malaspina Expedition
• Type: Environmental
• Taxonomy: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments

• Environment Ontology (ENVO): marine biome → marine water body → sea water
• Earth Microbiome Project Ontology (EMPO): Free-living → Saline → Water (saline)

Location Information

• Location: West of El Salvador, Pacific Ocean
• Coordinates
  • Lat. (^o): 10.09
  • Long. (^o): -99.25
  • Alt. (m): N/A
  • Depth (m): 3007.91

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032684	Metagenome / Metatranscriptome	179	Y

Associated Scaffolds

Scaffold	Taxonomy	Length
JGI12097J13213_1003884	Not Available	852

Sequences

Scaffold ID	Protein ID	Family	Sequence
JGI12097J13213_1003884	JGI12097J13213_10038842	F032684	MRLLCTLRVLALIDKFKSNFSLFRAEEVIFLPFGIITKNTLKNIIQPKITPTDKNANLDPKIFVKQNEITAPIMSSTTIKIIFLFINLDLQIRS*